Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4480751..4481370 Replicon chromosome
Accession NZ_CP117853
Organism Klebsiella michiganensis strain 2020CK-00215

Toxin (Protein)


Gene name Hha Uniprot ID H3N9D8
Locus tag PUO96_RS21060 Protein ID WP_004099646.1
Coordinates 4481152..4481370 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A0J2I7Z1
Locus tag PUO96_RS21055 Protein ID WP_025107145.1
Coordinates 4480751..4481125 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUO96_RS21045 (PUO96_21045) 4475906..4477099 + 1194 WP_004136054.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
PUO96_RS21050 (PUO96_21050) 4477122..4480268 + 3147 WP_014228207.1 multidrug efflux RND transporter permease subunit AcrB -
PUO96_RS21055 (PUO96_21055) 4480751..4481125 + 375 WP_025107145.1 Hha toxicity modulator TomB Antitoxin
PUO96_RS21060 (PUO96_21060) 4481152..4481370 + 219 WP_004099646.1 HHA domain-containing protein Toxin
PUO96_RS21065 (PUO96_21065) 4481533..4482099 + 567 WP_064357999.1 maltose O-acetyltransferase -
PUO96_RS21070 (PUO96_21070) 4482071..4482205 - 135 WP_224243896.1 hypothetical protein -
PUO96_RS21075 (PUO96_21075) 4482226..4482696 + 471 WP_004848329.1 YlaC family protein -
PUO96_RS21080 (PUO96_21080) 4482671..4484125 - 1455 WP_064405080.1 PLP-dependent aminotransferase family protein -
PUO96_RS21085 (PUO96_21085) 4484227..4484925 + 699 WP_048261453.1 GNAT family protein -
PUO96_RS21090 (PUO96_21090) 4484922..4485062 - 141 WP_003859006.1 type B 50S ribosomal protein L36 -
PUO96_RS21095 (PUO96_21095) 4485062..4485325 - 264 WP_004848323.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-115)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8640.05 Da        Isoelectric Point: 8.9008

>T272419 WP_004099646.1 NZ_CP117853:4481152-4481370 [Klebsiella michiganensis]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14366.15 Da        Isoelectric Point: 4.8989

>AT272419 WP_025107145.1 NZ_CP117853:4480751-4481125 [Klebsiella michiganensis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNACRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3H713

Antitoxin

Source ID Structure
AlphaFold DB A0A0J2I7Z1

References