Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 2019005..2019595 | Replicon | chromosome |
| Accession | NZ_CP117853 | ||
| Organism | Klebsiella michiganensis strain 2020CK-00215 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | A0A1F2LYA2 |
| Locus tag | PUO96_RS09570 | Protein ID | WP_008804165.1 |
| Coordinates | 2019263..2019595 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | PUO96_RS09565 | Protein ID | WP_064405693.1 |
| Coordinates | 2019005..2019262 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUO96_RS09550 (PUO96_09550) | 2016330..2017823 | - | 1494 | WP_274229442.1 | hypothetical protein | - |
| PUO96_RS09555 (PUO96_09555) | 2017895..2018284 | - | 390 | WP_274229443.1 | hypothetical protein | - |
| PUO96_RS09560 (PUO96_09560) | 2018541..2018744 | + | 204 | WP_224243742.1 | helix-turn-helix domain-containing protein | - |
| PUO96_RS09565 (PUO96_09565) | 2019005..2019262 | + | 258 | WP_064405693.1 | hypothetical protein | Antitoxin |
| PUO96_RS09570 (PUO96_09570) | 2019263..2019595 | + | 333 | WP_008804165.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PUO96_RS09580 (PUO96_09580) | 2019919..2021376 | + | 1458 | WP_025106072.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
| PUO96_RS09590 (PUO96_09590) | 2022338..2023792 | - | 1455 | WP_014229909.1 | AMP nucleosidase | - |
| PUO96_RS09595 (PUO96_09595) | 2023925..2024182 | - | 258 | WP_014229908.1 | histidine kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2001863..2019595 | 17732 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11867.71 Da Isoelectric Point: 10.1839
>T272414 WP_008804165.1 NZ_CP117853:2019263-2019595 [Klebsiella michiganensis]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|