Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 917855..918512 | Replicon | chromosome |
Accession | NZ_CP117853 | ||
Organism | Klebsiella michiganensis strain 2020CK-00215 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | PUO96_RS04410 | Protein ID | WP_064404221.1 |
Coordinates | 918102..918512 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | H3N295 |
Locus tag | PUO96_RS04405 | Protein ID | WP_004124953.1 |
Coordinates | 917855..918121 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUO96_RS04390 (PUO96_04390) | 913089..913514 | - | 426 | WP_004854067.1 | PTS sugar transporter subunit IIA | - |
PUO96_RS04395 (PUO96_04395) | 913635..916433 | - | 2799 | WP_014226794.1 | transcriptional regulator DagR | - |
PUO96_RS04400 (PUO96_04400) | 916627..917610 | - | 984 | WP_014226793.1 | tRNA-modifying protein YgfZ | - |
PUO96_RS04405 (PUO96_04405) | 917855..918121 | + | 267 | WP_004124953.1 | FAD assembly factor SdhE | Antitoxin |
PUO96_RS04410 (PUO96_04410) | 918102..918512 | + | 411 | WP_064404221.1 | protein YgfX | Toxin |
PUO96_RS04415 (PUO96_04415) | 918521..919042 | - | 522 | WP_014226792.1 | flavodoxin FldB | - |
PUO96_RS04420 (PUO96_04420) | 919164..920060 | + | 897 | WP_004105555.1 | site-specific tyrosine recombinase XerD | - |
PUO96_RS04425 (PUO96_04425) | 920083..920796 | + | 714 | WP_274229438.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PUO96_RS04430 (PUO96_04430) | 920802..922535 | + | 1734 | WP_032751182.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16122.97 Da Isoelectric Point: 10.9455
>T272413 WP_064404221.1 NZ_CP117853:918102-918512 [Klebsiella michiganensis]
VVLWQSDLRISWRAQWFSLLMHGVVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIIGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDSGEWRDLRRLVLLKPTQE
VVLWQSDLRISWRAQWFSLLMHGVVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIIGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDSGEWRDLRRLVLLKPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|