Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 761486..762272 | Replicon | chromosome |
Accession | NZ_CP117853 | ||
Organism | Klebsiella michiganensis strain 2020CK-00215 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A097QYR4 |
Locus tag | PUO96_RS03630 | Protein ID | WP_025799003.1 |
Coordinates | 761895..762272 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A097QYU1 |
Locus tag | PUO96_RS03625 | Protein ID | WP_025799001.1 |
Coordinates | 761486..761845 (+) | Length | 120 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUO96_RS03605 (PUO96_03605) | 756930..760082 | + | 3153 | WP_049015608.1 | autotransporter domain-containing protein | - |
PUO96_RS03610 (PUO96_03610) | 760305..760736 | + | 432 | WP_088903392.1 | antirestriction protein | - |
PUO96_RS03615 (PUO96_03615) | 760748..761227 | + | 480 | WP_025798999.1 | DNA repair protein RadC | - |
PUO96_RS03620 (PUO96_03620) | 761241..761462 | + | 222 | WP_045888217.1 | DUF987 domain-containing protein | - |
PUO96_RS03625 (PUO96_03625) | 761486..761845 | + | 360 | WP_025799001.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
PUO96_RS03630 (PUO96_03630) | 761895..762272 | + | 378 | WP_025799003.1 | TA system toxin CbtA family protein | Toxin |
PUO96_RS03635 (PUO96_03635) | 762269..762760 | + | 492 | WP_045888216.1 | DUF5983 family protein | - |
PUO96_RS03640 (PUO96_03640) | 762789..762992 | + | 204 | WP_025799007.1 | DUF957 domain-containing protein | - |
PUO96_RS03645 (PUO96_03645) | 763074..763919 | + | 846 | WP_049016442.1 | DUF4942 domain-containing protein | - |
PUO96_RS03655 (PUO96_03655) | 764222..764728 | + | 507 | WP_009651862.1 | G/U mismatch-specific DNA glycosylase | - |
PUO96_RS03660 (PUO96_03660) | 764798..765460 | - | 663 | WP_064404271.1 | TetR/AcrR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 729286..762272 | 32986 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13993.97 Da Isoelectric Point: 6.8515
>T272412 WP_025799003.1 NZ_CP117853:761895-762272 [Klebsiella michiganensis]
MQTQPVPPTQEASPRPSPVEIWLRLLSHLLDRHYGLTLNDTPFCNDGVIQEHIDAGISLCDAVNFIVEKYALIRTDRHGF
SAETQSPLISSIDILRARKACGLMARNGYRLVTDITTGKYSEVTR
MQTQPVPPTQEASPRPSPVEIWLRLLSHLLDRHYGLTLNDTPFCNDGVIQEHIDAGISLCDAVNFIVEKYALIRTDRHGF
SAETQSPLISSIDILRARKACGLMARNGYRLVTDITTGKYSEVTR
Download Length: 378 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13249.13 Da Isoelectric Point: 6.9556
>AT272412 WP_025799001.1 NZ_CP117853:761486-761845 [Klebsiella michiganensis]
MSNKIPPVNHNIAEPWWGLKRDITPCFGARLVQEGNRLHYLADRASITGQFSDADLRHLDQAFPLLLKQLELMLTSGELN
PRHQHGVTLYAKGLTCNADTLGSCGYVYIAIYPTPATTE
MSNKIPPVNHNIAEPWWGLKRDITPCFGARLVQEGNRLHYLADRASITGQFSDADLRHLDQAFPLLLKQLELMLTSGELN
PRHQHGVTLYAKGLTCNADTLGSCGYVYIAIYPTPATTE
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A097QYR4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A097QYU1 |