Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 56771..57318 | Replicon | chromosome |
Accession | NZ_CP117853 | ||
Organism | Klebsiella michiganensis strain 2020CK-00215 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | A0A0H3H5T3 |
Locus tag | PUO96_RS00285 | Protein ID | WP_014227299.1 |
Coordinates | 56771..57079 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | A0A0H3H0P7 |
Locus tag | PUO96_RS00290 | Protein ID | WP_014227298.1 |
Coordinates | 57082..57318 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUO96_RS00260 (PUO96_00260) | 52687..52998 | - | 312 | WP_014227304.1 | PTS sugar transporter subunit IIB | - |
PUO96_RS00265 (PUO96_00265) | 53293..54234 | + | 942 | WP_025107585.1 | LacI family DNA-binding transcriptional regulator | - |
PUO96_RS00270 (PUO96_00270) | 54258..54551 | - | 294 | WP_064357598.1 | YicS family protein | - |
PUO96_RS00275 (PUO96_00275) | 54761..55714 | + | 954 | WP_032751828.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
PUO96_RS00280 (PUO96_00280) | 55718..56620 | - | 903 | WP_014227300.1 | EamA family transporter | - |
PUO96_RS00285 (PUO96_00285) | 56771..57079 | - | 309 | WP_014227299.1 | CcdB family protein | Toxin |
PUO96_RS00290 (PUO96_00290) | 57082..57318 | - | 237 | WP_014227298.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
PUO96_RS00295 (PUO96_00295) | 57424..58857 | - | 1434 | WP_049083310.1 | PTS N-acetylmuramic acid transporter subunit IIBC | - |
PUO96_RS00300 (PUO96_00300) | 58882..59784 | - | 903 | WP_032752002.1 | N-acetylmuramic acid 6-phosphate etherase | - |
PUO96_RS00305 (PUO96_00305) | 59945..61111 | - | 1167 | WP_064406020.1 | multidrug effflux MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11725.57 Da Isoelectric Point: 7.2729
>T272411 WP_014227299.1 NZ_CP117853:c57079-56771 [Klebsiella michiganensis]
MQYYVYKNTGRIAAYPYLLDVQSDIIGKRNTRVVIPLFPLKNYKGPRADRLTPLVTVEGEEYVVMTHELASIPHRVLGEE
VCNLNHQREVVKASMDFLFDGI
MQYYVYKNTGRIAAYPYLLDVQSDIIGKRNTRVVIPLFPLKNYKGPRADRLTPLVTVEGEEYVVMTHELASIPHRVLGEE
VCNLNHQREVVKASMDFLFDGI
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3H5T3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3H0P7 |