Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4324982..4325602 | Replicon | chromosome |
Accession | NZ_CP117852 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F28R |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PTZ66_RS21175 | Protein ID | WP_001280991.1 |
Coordinates | 4325384..4325602 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PTZ66_RS21170 | Protein ID | WP_000344807.1 |
Coordinates | 4324982..4325356 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTZ66_RS21160 (4320121) | 4320121..4321314 | + | 1194 | WP_001039199.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PTZ66_RS21165 (4321337) | 4321337..4324486 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
PTZ66_RS21170 (4324982) | 4324982..4325356 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PTZ66_RS21175 (4325384) | 4325384..4325602 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PTZ66_RS21180 (4325781) | 4325781..4326332 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
PTZ66_RS21185 (4326448) | 4326448..4326918 | + | 471 | WP_000136183.1 | YlaC family protein | - |
PTZ66_RS21190 (4326974) | 4326974..4327114 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PTZ66_RS21195 (4327120) | 4327120..4327380 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PTZ66_RS21200 (4327605) | 4327605..4329155 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
PTZ66_RS21210 (4329386) | 4329386..4329775 | + | 390 | WP_000961285.1 | MGMT family protein | - |
PTZ66_RS21215 (4329808) | 4329808..4330377 | - | 570 | WP_000779801.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T272404 WP_001280991.1 NZ_CP117852:4325384-4325602 [Salmonella enterica subsp. enterica serovar Mbandaka]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT272404 WP_000344807.1 NZ_CP117852:4324982-4325356 [Salmonella enterica subsp. enterica serovar Mbandaka]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|