Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 3283225..3283747 | Replicon | chromosome |
Accession | NZ_CP117852 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F28R |
Toxin (Protein)
Gene name | stbE | Uniprot ID | V7IL40 |
Locus tag | PTZ66_RS15945 | Protein ID | WP_000221345.1 |
Coordinates | 3283463..3283747 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | PTZ66_RS15940 | Protein ID | WP_000885424.1 |
Coordinates | 3283225..3283473 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTZ66_RS15910 (3278768) | 3278768..3279548 | + | 781 | Protein_3095 | helix-turn-helix domain-containing protein | - |
PTZ66_RS15915 (3279550) | 3279550..3280458 | - | 909 | WP_077906523.1 | hypothetical protein | - |
PTZ66_RS15920 (3280731) | 3280731..3281063 | - | 333 | WP_017441352.1 | DUF1493 family protein | - |
PTZ66_RS15925 (3281586) | 3281586..3281702 | - | 117 | Protein_3098 | IS110 family transposase | - |
PTZ66_RS15930 (3282067) | 3282067..3282456 | + | 390 | WP_017441353.1 | hypothetical protein | - |
PTZ66_RS15935 (3282459) | 3282459..3282812 | + | 354 | WP_000418733.1 | hypothetical protein | - |
PTZ66_RS15940 (3283225) | 3283225..3283473 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PTZ66_RS15945 (3283463) | 3283463..3283747 | + | 285 | WP_000221345.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PTZ66_RS15950 (3283918) | 3283918..3284307 | + | 390 | WP_001652798.1 | RidA family protein | - |
PTZ66_RS15955 (3284365) | 3284365..3285438 | - | 1074 | WP_017441355.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
PTZ66_RS15960 (3285631) | 3285631..3286119 | - | 489 | WP_017441356.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
PTZ66_RS15965 (3286164) | 3286164..3287672 | + | 1509 | WP_017441357.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3274019..3290529 | 16510 | |
- | inside | Genomic island | - | - | 3280731..3290529 | 9798 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11043.79 Da Isoelectric Point: 10.6500
>T272403 WP_000221345.1 NZ_CP117852:3283463-3283747 [Salmonella enterica subsp. enterica serovar Mbandaka]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Y2FFA8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |