Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1925147..1925961 | Replicon | chromosome |
Accession | NZ_CP117852 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F28R |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | A0A3W0Q3Z8 |
Locus tag | PTZ66_RS09330 | Protein ID | WP_017441137.1 |
Coordinates | 1925147..1925674 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | A0A418Z520 |
Locus tag | PTZ66_RS09335 | Protein ID | WP_017441138.1 |
Coordinates | 1925671..1925961 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTZ66_RS09300 (1921520) | 1921520..1921918 | + | 399 | Protein_1803 | cytoplasmic protein | - |
PTZ66_RS09305 (1922109) | 1922109..1922348 | + | 240 | Protein_1804 | hypothetical protein | - |
PTZ66_RS09310 (1922505) | 1922505..1923173 | + | 669 | WP_000445914.1 | hypothetical protein | - |
PTZ66_RS09315 (1923200) | 1923200..1923694 | + | 495 | WP_000424947.1 | hypothetical protein | - |
PTZ66_RS09320 (1923865) | 1923865..1924521 | - | 657 | WP_017441135.1 | protein-serine/threonine phosphatase | - |
PTZ66_RS09325 (1924859) | 1924859..1925074 | + | 216 | Protein_1808 | IS5/IS1182 family transposase | - |
PTZ66_RS09330 (1925147) | 1925147..1925674 | - | 528 | WP_017441137.1 | GNAT family N-acetyltransferase | Toxin |
PTZ66_RS09335 (1925671) | 1925671..1925961 | - | 291 | WP_017441138.1 | DUF1778 domain-containing protein | Antitoxin |
PTZ66_RS09340 (1926231) | 1926231..1926431 | - | 201 | Protein_1811 | IS3 family transposase | - |
PTZ66_RS09345 (1926672) | 1926672..1926998 | + | 327 | WP_000393295.1 | hypothetical protein | - |
PTZ66_RS09350 (1927271) | 1927271..1927618 | - | 348 | WP_001555786.1 | DUF1493 family protein | - |
PTZ66_RS09355 (1927603) | 1927603..1928052 | - | 450 | WP_017441139.1 | hypothetical protein | - |
PTZ66_RS09360 (1928484) | 1928484..1928927 | - | 444 | WP_017441140.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
PTZ66_RS09365 (1929383) | 1929383..1930033 | + | 651 | WP_001728903.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1924934..1935346 | 10412 | |
- | flank | IS/Tn | - | - | 1924934..1925074 | 140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19035.89 Da Isoelectric Point: 9.6420
>T272397 WP_017441137.1 NZ_CP117852:c1925674-1925147 [Salmonella enterica subsp. enterica serovar Mbandaka]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SLKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SLKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10721.55 Da Isoelectric Point: 8.5957
>AT272397 WP_017441138.1 NZ_CP117852:c1925961-1925671 [Salmonella enterica subsp. enterica serovar Mbandaka]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFARPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFARPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3W0Q3Z8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A418Z520 |