Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 1250548..1251134 Replicon chromosome
Accession NZ_CP117852
Organism Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F28R

Toxin (Protein)


Gene name doc Uniprot ID Q57IR9
Locus tag PTZ66_RS06045 Protein ID WP_000174963.1
Coordinates 1250766..1251134 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag PTZ66_RS06040 Protein ID WP_001520924.1
Coordinates 1250548..1250769 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTZ66_RS06015 (1245569) 1245569..1246678 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
PTZ66_RS06020 (1246738) 1246738..1247664 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PTZ66_RS06025 (1247661) 1247661..1248938 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
PTZ66_RS06030 (1248935) 1248935..1249702 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PTZ66_RS06035 (1249704) 1249704..1250417 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PTZ66_RS06040 (1250548) 1250548..1250769 + 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PTZ66_RS06045 (1250766) 1250766..1251134 + 369 WP_000174963.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PTZ66_RS06050 (1251393) 1251393..1252709 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PTZ66_RS06055 (1252814) 1252814..1253701 + 888 WP_000094074.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PTZ66_RS06060 (1253698) 1253698..1254543 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PTZ66_RS06065 (1254546) 1254546..1255616 + 1071 WP_000907842.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage aph(6)-Id / ARR-3 / mph(A) - 1233809..1256353 22544
- inside Prophage aph(6)-Id / ARR-3 / mph(A) - 1233090..1256353 23263


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13573.85 Da        Isoelectric Point: 6.7252

>T272394 WP_000174963.1 NZ_CP117852:1250766-1251134 [Salmonella enterica subsp. enterica serovar Mbandaka]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT272394 WP_001520924.1 NZ_CP117852:1250548-1250769 [Salmonella enterica subsp. enterica serovar Mbandaka]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5H6KCD5

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References