Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ataRT/DUF1778(antitoxin)
Location 1243976..1244767 Replicon chromosome
Accession NZ_CP117852
Organism Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F28R

Toxin (Protein)


Gene name ataT Uniprot ID C0Q119
Locus tag PTZ66_RS06005 Protein ID WP_000369560.1
Coordinates 1244249..1244767 (+) Length 173 a.a.

Antitoxin (Protein)


Gene name ataR Uniprot ID Q57IR1
Locus tag PTZ66_RS06000 Protein ID WP_001275017.1
Coordinates 1243976..1244245 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTZ66_RS05975 (1239703) 1239703..1240939 + 1237 Protein_1153 macrolide resistance MFS transporter Mrx(A) -
PTZ66_RS05980 (1240939) 1240939..1241523 + 585 WP_001137892.1 macrolide-binding transcriptional repressor MphR(A) -
PTZ66_RS05985 (1242016) 1242016..1242321 - 306 WP_065311134.1 DDE-type integrase/transposase/recombinase -
PTZ66_RS05990 (1242346) 1242346..1243050 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
PTZ66_RS05995 (1243103) 1243103..1243798 + 696 Protein_1157 branched chain amino acid ABC transporter substrate-binding protein LivJ -
PTZ66_RS06000 (1243976) 1243976..1244245 + 270 WP_001275017.1 DUF1778 domain-containing protein Antitoxin
PTZ66_RS06005 (1244249) 1244249..1244767 + 519 WP_000369560.1 GNAT family N-acetyltransferase Toxin
PTZ66_RS06010 (1244764) 1244764..1245147 - 384 WP_000778873.1 aspartate 1-decarboxylase autocleavage activator PanM -
PTZ66_RS06015 (1245569) 1245569..1246678 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
PTZ66_RS06020 (1246738) 1246738..1247664 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PTZ66_RS06025 (1247661) 1247661..1248938 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
PTZ66_RS06030 (1248935) 1248935..1249702 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage aph(6)-Id / ARR-3 / mph(A) - 1233809..1256353 22544
- inside Prophage aph(6)-Id / ARR-3 / mph(A) - 1233090..1256353 23263


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(90-150)

Antitoxin

Vibrio phage ICP1, Orf50

(8-86)


Sequences

Toxin        


Download         Length: 173 a.a.        Molecular weight: 19414.16 Da        Isoelectric Point: 8.9619

>T272393 WP_000369560.1 NZ_CP117852:1244249-1244767 [Salmonella enterica subsp. enterica serovar Mbandaka]
VDNLTIEILADNAEYNWRQFDCGEASLNLFLTQHLQRQHNNKILRGYVLRTTTPERRVLGYYTLSGSCFERASLPSRTQQ
KRIPYQNIPSVTLGRLAVDLSLQGKGWGAILVTHAMKVVWSASLAVGIHGIFVEALNEKAQAFYQRLGFISLSGENEHAL
FYPTKSIEQLFG

Download         Length: 519 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10086.53 Da        Isoelectric Point: 7.2056

>AT272393 WP_001275017.1 NZ_CP117852:1243976-1244245 [Salmonella enterica subsp. enterica serovar Mbandaka]
MSALKKQRIDLRLTDGDKSMIEEAAAITNQSITQFMLNSAAERAAEVLEQHRRVILNEASWARVMDALSHPPTPNEKLKR
AAQRLQDME

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5H5BA59

Antitoxin

Source ID Structure
AlphaFold DB A0A5I8URP5

References