Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 1034962..1035512 Replicon chromosome
Accession NZ_CP117852
Organism Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F28R

Toxin (Protein)


Gene name ccdB Uniprot ID M7RJ32
Locus tag PTZ66_RS04945 Protein ID WP_001199743.1
Coordinates 1035204..1035512 (+) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V7ITQ8
Locus tag PTZ66_RS04940 Protein ID WP_000016244.1
Coordinates 1034962..1035201 (+) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTZ66_RS04910 (1030888) 1030888..1031418 + 531 WP_017441181.1 gluconokinase -
PTZ66_RS04915 (1031446) 1031446..1032465 - 1020 WP_000152563.1 NAD(P)-dependent alcohol dehydrogenase -
PTZ66_RS04925 (1033223) 1033223..1034200 + 978 WP_223195356.1 IS630 family transposase -
PTZ66_RS04930 (1034220) 1034220..1034528 + 309 Protein_947 DUF4942 domain-containing protein -
PTZ66_RS04935 (1034629) 1034629..1034853 + 225 WP_031233173.1 ribbon-helix-helix protein, CopG family -
PTZ66_RS04940 (1034962) 1034962..1035201 + 240 WP_000016244.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
PTZ66_RS04945 (1035204) 1035204..1035512 + 309 WP_001199743.1 CcdB family protein Toxin
PTZ66_RS04950 (1035879) 1035879..1036805 - 927 WP_017441178.1 site-specific integrase -
PTZ66_RS04955 (1036795) 1036795..1038414 - 1620 WP_017441177.1 MobH family relaxase -
PTZ66_RS04960 (1038705) 1038705..1039160 - 456 WP_031615695.1 NUDIX domain-containing protein -
PTZ66_RS04965 (1039266) 1039266..1040177 - 912 WP_017441175.1 zincin-like metallopeptidase domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1033268..1049702 16434
- flank IS/Tn - - 1033268..1034200 932


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11845.67 Da        Isoelectric Point: 6.7228

>T272391 WP_001199743.1 NZ_CP117852:1035204-1035512 [Salmonella enterica subsp. enterica serovar Mbandaka]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8709.86 Da        Isoelectric Point: 6.4633

>AT272391 WP_000016244.1 NZ_CP117852:1034962-1035201 [Salmonella enterica subsp. enterica serovar Mbandaka]
MSGMSVRHKKTVSVTLEPALLQQARDAGINLSAVLTAALKEEISATGVERWKAENRAGLQELNRITDEHGLLSDDYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C6Z9V9

Antitoxin

Source ID Structure
AlphaFold DB A0A5I5T4R8

References