Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 1034962..1035512 | Replicon | chromosome |
| Accession | NZ_CP117852 | ||
| Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F28R | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | M7RJ32 |
| Locus tag | PTZ66_RS04945 | Protein ID | WP_001199743.1 |
| Coordinates | 1035204..1035512 (+) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | V7ITQ8 |
| Locus tag | PTZ66_RS04940 | Protein ID | WP_000016244.1 |
| Coordinates | 1034962..1035201 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTZ66_RS04910 (1030888) | 1030888..1031418 | + | 531 | WP_017441181.1 | gluconokinase | - |
| PTZ66_RS04915 (1031446) | 1031446..1032465 | - | 1020 | WP_000152563.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| PTZ66_RS04925 (1033223) | 1033223..1034200 | + | 978 | WP_223195356.1 | IS630 family transposase | - |
| PTZ66_RS04930 (1034220) | 1034220..1034528 | + | 309 | Protein_947 | DUF4942 domain-containing protein | - |
| PTZ66_RS04935 (1034629) | 1034629..1034853 | + | 225 | WP_031233173.1 | ribbon-helix-helix protein, CopG family | - |
| PTZ66_RS04940 (1034962) | 1034962..1035201 | + | 240 | WP_000016244.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| PTZ66_RS04945 (1035204) | 1035204..1035512 | + | 309 | WP_001199743.1 | CcdB family protein | Toxin |
| PTZ66_RS04950 (1035879) | 1035879..1036805 | - | 927 | WP_017441178.1 | site-specific integrase | - |
| PTZ66_RS04955 (1036795) | 1036795..1038414 | - | 1620 | WP_017441177.1 | MobH family relaxase | - |
| PTZ66_RS04960 (1038705) | 1038705..1039160 | - | 456 | WP_031615695.1 | NUDIX domain-containing protein | - |
| PTZ66_RS04965 (1039266) | 1039266..1040177 | - | 912 | WP_017441175.1 | zincin-like metallopeptidase domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1033268..1049702 | 16434 | |
| - | flank | IS/Tn | - | - | 1033268..1034200 | 932 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T272391 WP_001199743.1 NZ_CP117852:1035204-1035512 [Salmonella enterica subsp. enterica serovar Mbandaka]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I5T4R8 |