Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 993285..993928 | Replicon | chromosome |
Accession | NZ_CP117852 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F28R |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | PTZ66_RS04735 | Protein ID | WP_017441191.1 |
Coordinates | 993285..993701 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B5F3H9 |
Locus tag | PTZ66_RS04740 | Protein ID | WP_001261294.1 |
Coordinates | 993698..993928 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTZ66_RS04715 (988322) | 988322..989455 | + | 1134 | WP_017441192.1 | amidohydrolase/deacetylase family metallohydrolase | - |
PTZ66_RS04720 (989439) | 989439..990557 | + | 1119 | WP_001139194.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
PTZ66_RS04725 (990554) | 990554..991294 | + | 741 | WP_023229489.1 | KDGP aldolase family protein | - |
PTZ66_RS04730 (991311) | 991311..993224 | + | 1914 | WP_023242878.1 | BglG family transcription antiterminator | - |
PTZ66_RS04735 (993285) | 993285..993701 | - | 417 | WP_017441191.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PTZ66_RS04740 (993698) | 993698..993928 | - | 231 | WP_001261294.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PTZ66_RS04745 (994095) | 994095..994559 | - | 465 | WP_017441190.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
PTZ66_RS04750 (994776) | 994776..996914 | - | 2139 | WP_000187821.1 | anaerobic ribonucleoside-triphosphate reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15163.55 Da Isoelectric Point: 8.1381
>T272390 WP_017441191.1 NZ_CP117852:c993701-993285 [Salmonella enterica subsp. enterica serovar Mbandaka]
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAVGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAVGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|