Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 3761320..3761842 | Replicon | chromosome |
Accession | NZ_CP117851 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_B30R |
Toxin (Protein)
Gene name | stbE | Uniprot ID | V7IL40 |
Locus tag | PTZ67_RS18405 | Protein ID | WP_000221345.1 |
Coordinates | 3761320..3761604 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | PTZ67_RS18410 | Protein ID | WP_000885424.1 |
Coordinates | 3761594..3761842 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTZ67_RS18385 (3757395) | 3757395..3758903 | - | 1509 | WP_017441357.1 | FAD-dependent oxidoreductase | - |
PTZ67_RS18390 (3758948) | 3758948..3759436 | + | 489 | WP_017441356.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
PTZ67_RS18395 (3759629) | 3759629..3760702 | + | 1074 | WP_017441355.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
PTZ67_RS18400 (3760760) | 3760760..3761149 | - | 390 | WP_001652798.1 | RidA family protein | - |
PTZ67_RS18405 (3761320) | 3761320..3761604 | - | 285 | WP_000221345.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PTZ67_RS18410 (3761594) | 3761594..3761842 | - | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PTZ67_RS18415 (3762255) | 3762255..3762608 | - | 354 | WP_000418733.1 | hypothetical protein | - |
PTZ67_RS18420 (3762611) | 3762611..3763000 | - | 390 | WP_017441353.1 | hypothetical protein | - |
PTZ67_RS18425 (3763365) | 3763365..3763481 | + | 117 | Protein_3586 | IS110 family transposase | - |
PTZ67_RS18430 (3764004) | 3764004..3764336 | + | 333 | WP_017441352.1 | DUF1493 family protein | - |
PTZ67_RS18435 (3764609) | 3764609..3765517 | + | 909 | WP_077906523.1 | hypothetical protein | - |
PTZ67_RS18440 (3765519) | 3765519..3766299 | - | 781 | Protein_3589 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3759629..3771048 | 11419 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11043.79 Da Isoelectric Point: 10.6500
>T272381 WP_000221345.1 NZ_CP117851:c3761604-3761320 [Salmonella enterica subsp. enterica serovar Mbandaka]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Y2FFA8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |