Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1346983..1347764 | Replicon | chromosome |
Accession | NZ_CP117851 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_B30R |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A3G3E5T9 |
Locus tag | PTZ67_RS06720 | Protein ID | WP_000625911.1 |
Coordinates | 1346983..1347474 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | V7IUD2 |
Locus tag | PTZ67_RS06725 | Protein ID | WP_001271379.1 |
Coordinates | 1347471..1347764 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTZ67_RS06695 (1342117) | 1342117..1344555 | - | 2439 | WP_017441226.1 | F4 (K88) fimbrial usher FaeD | - |
PTZ67_RS06700 (1344565) | 1344565..1345104 | - | 540 | WP_000721295.1 | type 1 fimbrial protein | - |
PTZ67_RS06705 (1345139) | 1345139..1345429 | - | 291 | WP_000773469.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
PTZ67_RS06710 (1346017) | 1346017..1346274 | + | 258 | WP_001112996.1 | hypothetical protein | - |
PTZ67_RS06715 (1346520) | 1346520..1346768 | - | 249 | Protein_1309 | IS481 family transposase | - |
PTZ67_RS06720 (1346983) | 1346983..1347474 | - | 492 | WP_000625911.1 | GNAT family N-acetyltransferase | Toxin |
PTZ67_RS06725 (1347471) | 1347471..1347764 | - | 294 | WP_001271379.1 | DUF1778 domain-containing protein | Antitoxin |
PTZ67_RS06730 (1348082) | 1348082..1348303 | + | 222 | WP_001595143.1 | hypothetical protein | - |
PTZ67_RS06735 (1348569) | 1348569..1349444 | + | 876 | WP_017441228.1 | AraC family transcriptional regulator | - |
PTZ67_RS06740 (1349441) | 1349441..1349728 | + | 288 | WP_072103482.1 | transcriptional regulator RtsB | - |
PTZ67_RS06745 (1349735) | 1349735..1349902 | - | 168 | WP_071527476.1 | ATP-binding cassette domain-containing protein | - |
PTZ67_RS06750 (1349922) | 1349922..1350021 | + | 100 | Protein_1316 | hypothetical protein | - |
PTZ67_RS06755 (1350069) | 1350069..1350263 | + | 195 | WP_223195369.1 | hypothetical protein | - |
PTZ67_RS06760 (1350557) | 1350557..1351462 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | faeI / faeH / faeF / faeE / faeD / faeC | 1335373..1349728 | 14355 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17663.44 Da Isoelectric Point: 7.2655
>T272371 WP_000625911.1 NZ_CP117851:c1347474-1346983 [Salmonella enterica subsp. enterica serovar Mbandaka]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFEPSPMDPMMLMVTLGDLV
ESV
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFEPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10938.54 Da Isoelectric Point: 9.8590
>AT272371 WP_001271379.1 NZ_CP117851:c1347764-1347471 [Salmonella enterica subsp. enterica serovar Mbandaka]
MSAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
MSAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G3E5T9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V7IUD2 |