Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 1202304..1202947 | Replicon | chromosome |
| Accession | NZ_CP117851 | ||
| Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_B30R | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | PTZ67_RS05980 | Protein ID | WP_017441191.1 |
| Coordinates | 1202531..1202947 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B5F3H9 |
| Locus tag | PTZ67_RS05975 | Protein ID | WP_001261294.1 |
| Coordinates | 1202304..1202534 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTZ67_RS05965 (1199318) | 1199318..1201456 | + | 2139 | WP_000187821.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| PTZ67_RS05970 (1201673) | 1201673..1202137 | + | 465 | WP_017441190.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| PTZ67_RS05975 (1202304) | 1202304..1202534 | + | 231 | WP_001261294.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PTZ67_RS05980 (1202531) | 1202531..1202947 | + | 417 | WP_017441191.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PTZ67_RS05985 (1203008) | 1203008..1204921 | - | 1914 | WP_023242878.1 | BglG family transcription antiterminator | - |
| PTZ67_RS05990 (1204938) | 1204938..1205678 | - | 741 | WP_023229489.1 | KDGP aldolase family protein | - |
| PTZ67_RS05995 (1205675) | 1205675..1206793 | - | 1119 | WP_001139194.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| PTZ67_RS06000 (1206777) | 1206777..1207910 | - | 1134 | WP_017441192.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15163.55 Da Isoelectric Point: 8.1381
>T272370 WP_017441191.1 NZ_CP117851:1202531-1202947 [Salmonella enterica subsp. enterica serovar Mbandaka]
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAVGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAVGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|