Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 1160720..1161270 Replicon chromosome
Accession NZ_CP117851
Organism Salmonella enterica subsp. enterica serovar Mbandaka strain SM_B30R

Toxin (Protein)


Gene name ccdB Uniprot ID M7RJ32
Locus tag PTZ67_RS05770 Protein ID WP_001199743.1
Coordinates 1160720..1161028 (-) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V7ITQ8
Locus tag PTZ67_RS05775 Protein ID WP_000016244.1
Coordinates 1161031..1161270 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTZ67_RS05750 (1156055) 1156055..1156966 + 912 WP_017441175.1 zincin-like metallopeptidase domain-containing protein -
PTZ67_RS05755 (1157072) 1157072..1157527 + 456 WP_031615695.1 NUDIX domain-containing protein -
PTZ67_RS05760 (1157818) 1157818..1159437 + 1620 WP_017441177.1 MobH family relaxase -
PTZ67_RS05765 (1159427) 1159427..1160353 + 927 WP_017441178.1 site-specific integrase -
PTZ67_RS05770 (1160720) 1160720..1161028 - 309 WP_001199743.1 CcdB family protein Toxin
PTZ67_RS05775 (1161031) 1161031..1161270 - 240 WP_000016244.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
PTZ67_RS05780 (1161379) 1161379..1161603 - 225 WP_031233173.1 ribbon-helix-helix protein, CopG family -
PTZ67_RS05785 (1161704) 1161704..1162012 - 309 Protein_1128 DUF4942 domain-containing protein -
PTZ67_RS05790 (1162032) 1162032..1163009 - 978 WP_223195356.1 IS630 family transposase -
PTZ67_RS05800 (1163767) 1163767..1164786 + 1020 WP_000152563.1 NAD(P)-dependent alcohol dehydrogenase -
PTZ67_RS05805 (1164814) 1164814..1165344 - 531 WP_017441181.1 gluconokinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1146530..1162964 16434
- flank IS/Tn - - 1162032..1162964 932


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11845.67 Da        Isoelectric Point: 6.7228

>T272369 WP_001199743.1 NZ_CP117851:c1161028-1160720 [Salmonella enterica subsp. enterica serovar Mbandaka]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8709.86 Da        Isoelectric Point: 6.4633

>AT272369 WP_000016244.1 NZ_CP117851:c1161270-1161031 [Salmonella enterica subsp. enterica serovar Mbandaka]
MSGMSVRHKKTVSVTLEPALLQQARDAGINLSAVLTAALKEEISATGVERWKAENRAGLQELNRITDEHGLLSDDYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C6Z9V9

Antitoxin

Source ID Structure
AlphaFold DB A0A5I5T4R8

References