Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 1160720..1161270 | Replicon | chromosome |
Accession | NZ_CP117851 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_B30R |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | M7RJ32 |
Locus tag | PTZ67_RS05770 | Protein ID | WP_001199743.1 |
Coordinates | 1160720..1161028 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | V7ITQ8 |
Locus tag | PTZ67_RS05775 | Protein ID | WP_000016244.1 |
Coordinates | 1161031..1161270 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTZ67_RS05750 (1156055) | 1156055..1156966 | + | 912 | WP_017441175.1 | zincin-like metallopeptidase domain-containing protein | - |
PTZ67_RS05755 (1157072) | 1157072..1157527 | + | 456 | WP_031615695.1 | NUDIX domain-containing protein | - |
PTZ67_RS05760 (1157818) | 1157818..1159437 | + | 1620 | WP_017441177.1 | MobH family relaxase | - |
PTZ67_RS05765 (1159427) | 1159427..1160353 | + | 927 | WP_017441178.1 | site-specific integrase | - |
PTZ67_RS05770 (1160720) | 1160720..1161028 | - | 309 | WP_001199743.1 | CcdB family protein | Toxin |
PTZ67_RS05775 (1161031) | 1161031..1161270 | - | 240 | WP_000016244.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
PTZ67_RS05780 (1161379) | 1161379..1161603 | - | 225 | WP_031233173.1 | ribbon-helix-helix protein, CopG family | - |
PTZ67_RS05785 (1161704) | 1161704..1162012 | - | 309 | Protein_1128 | DUF4942 domain-containing protein | - |
PTZ67_RS05790 (1162032) | 1162032..1163009 | - | 978 | WP_223195356.1 | IS630 family transposase | - |
PTZ67_RS05800 (1163767) | 1163767..1164786 | + | 1020 | WP_000152563.1 | NAD(P)-dependent alcohol dehydrogenase | - |
PTZ67_RS05805 (1164814) | 1164814..1165344 | - | 531 | WP_017441181.1 | gluconokinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 1146530..1162964 | 16434 | |
- | flank | IS/Tn | - | - | 1162032..1162964 | 932 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T272369 WP_001199743.1 NZ_CP117851:c1161028-1160720 [Salmonella enterica subsp. enterica serovar Mbandaka]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I5T4R8 |