Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ataRT/DUF1778(antitoxin)
Location 951462..952253 Replicon chromosome
Accession NZ_CP117851
Organism Salmonella enterica subsp. enterica serovar Mbandaka strain SM_B30R

Toxin (Protein)


Gene name ataT Uniprot ID C0Q119
Locus tag PTZ67_RS04710 Protein ID WP_000369560.1
Coordinates 951462..951980 (-) Length 173 a.a.

Antitoxin (Protein)


Gene name ataR Uniprot ID Q57IR1
Locus tag PTZ67_RS04715 Protein ID WP_001275017.1
Coordinates 951984..952253 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTZ67_RS04685 (946527) 946527..947294 - 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PTZ67_RS04690 (947291) 947291..948568 - 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
PTZ67_RS04695 (948565) 948565..949491 - 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PTZ67_RS04700 (949551) 949551..950660 - 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
PTZ67_RS04705 (951082) 951082..951465 + 384 WP_000778873.1 aspartate 1-decarboxylase autocleavage activator PanM -
PTZ67_RS04710 (951462) 951462..951980 - 519 WP_000369560.1 GNAT family N-acetyltransferase Toxin
PTZ67_RS04715 (951984) 951984..952253 - 270 WP_001275017.1 DUF1778 domain-containing protein Antitoxin
PTZ67_RS04720 (952431) 952431..953126 - 696 Protein_918 branched chain amino acid ABC transporter substrate-binding protein LivJ -
PTZ67_RS04725 (953179) 953179..953883 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
PTZ67_RS04730 (953908) 953908..954213 + 306 WP_065311134.1 DDE-type integrase/transposase/recombinase -
PTZ67_RS04735 (954706) 954706..955290 - 585 WP_001137892.1 macrolide-binding transcriptional repressor MphR(A) -
PTZ67_RS04740 (955290) 955290..956525 - 1236 Protein_922 macrolide resistance MFS transporter Mrx(A) -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(90-150)

Antitoxin

Vibrio phage ICP1, Orf50

(8-86)


Sequences

Toxin        


Download         Length: 173 a.a.        Molecular weight: 19414.16 Da        Isoelectric Point: 8.9619

>T272367 WP_000369560.1 NZ_CP117851:c951980-951462 [Salmonella enterica subsp. enterica serovar Mbandaka]
VDNLTIEILADNAEYNWRQFDCGEASLNLFLTQHLQRQHNNKILRGYVLRTTTPERRVLGYYTLSGSCFERASLPSRTQQ
KRIPYQNIPSVTLGRLAVDLSLQGKGWGAILVTHAMKVVWSASLAVGIHGIFVEALNEKAQAFYQRLGFISLSGENEHAL
FYPTKSIEQLFG

Download         Length: 519 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10086.53 Da        Isoelectric Point: 7.2056

>AT272367 WP_001275017.1 NZ_CP117851:c952253-951984 [Salmonella enterica subsp. enterica serovar Mbandaka]
MSALKKQRIDLRLTDGDKSMIEEAAAITNQSITQFMLNSAAERAAEVLEQHRRVILNEASWARVMDALSHPPTPNEKLKR
AAQRLQDME

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5H5BA59

Antitoxin

Source ID Structure
AlphaFold DB A0A5I8URP5

References