272366

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 945095..945681 Replicon chromosome
Accession NZ_CP117851
Organism Salmonella enterica subsp. enterica serovar Mbandaka strain SM_B30R

Toxin (Protein)


Gene name doc Uniprot ID Q57IR9
Locus tag PTZ67_RS04670 Protein ID WP_000174963.1
Coordinates 945095..945463 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag PTZ67_RS04675 Protein ID WP_001520924.1
Coordinates 945460..945681 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTZ67_RS04650 (940613) 940613..941683 - 1071 WP_000907842.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
PTZ67_RS04655 (941686) 941686..942531 - 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PTZ67_RS04660 (942528) 942528..943415 - 888 WP_000094074.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PTZ67_RS04665 (943520) 943520..944836 - 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PTZ67_RS04670 (945095) 945095..945463 - 369 WP_000174963.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PTZ67_RS04675 (945460) 945460..945681 - 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PTZ67_RS04680 (945812) 945812..946525 - 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PTZ67_RS04685 (946527) 946527..947294 - 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PTZ67_RS04690 (947291) 947291..948568 - 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
PTZ67_RS04695 (948565) 948565..949491 - 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PTZ67_RS04700 (949551) 949551..950660 - 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13573.85 Da        Isoelectric Point: 6.7252

>T272366 WP_000174963.1 NZ_CP117851:c945463-945095 [Salmonella enterica subsp. enterica serovar Mbandaka]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT272366 WP_001520924.1 NZ_CP117851:c945681-945460 [Salmonella enterica subsp. enterica serovar Mbandaka]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5H6KCD5

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References