Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4391904..4392524 | Replicon | chromosome |
Accession | NZ_CP117850 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F22R |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PTZ65_RS21620 | Protein ID | WP_001280991.1 |
Coordinates | 4392306..4392524 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PTZ65_RS21615 | Protein ID | WP_000344807.1 |
Coordinates | 4391904..4392278 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTZ65_RS21605 (4387043) | 4387043..4388236 | + | 1194 | WP_001039199.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PTZ65_RS21610 (4388259) | 4388259..4391408 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
PTZ65_RS21615 (4391904) | 4391904..4392278 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PTZ65_RS21620 (4392306) | 4392306..4392524 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PTZ65_RS21625 (4392703) | 4392703..4393254 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
PTZ65_RS21630 (4393370) | 4393370..4393840 | + | 471 | WP_000136183.1 | YlaC family protein | - |
PTZ65_RS21635 (4393896) | 4393896..4394036 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PTZ65_RS21640 (4394042) | 4394042..4394302 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PTZ65_RS21645 (4394527) | 4394527..4396077 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
PTZ65_RS21655 (4396308) | 4396308..4396697 | + | 390 | WP_000961285.1 | MGMT family protein | - |
PTZ65_RS21660 (4396730) | 4396730..4397299 | - | 570 | WP_000779801.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T272356 WP_001280991.1 NZ_CP117850:4392306-4392524 [Salmonella enterica subsp. enterica serovar Mbandaka]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT272356 WP_000344807.1 NZ_CP117850:4391904-4392278 [Salmonella enterica subsp. enterica serovar Mbandaka]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|