Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 3350141..3350663 | Replicon | chromosome |
Accession | NZ_CP117850 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F22R |
Toxin (Protein)
Gene name | stbE | Uniprot ID | V7IL40 |
Locus tag | PTZ65_RS16380 | Protein ID | WP_000221345.1 |
Coordinates | 3350379..3350663 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | PTZ65_RS16375 | Protein ID | WP_000885424.1 |
Coordinates | 3350141..3350389 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTZ65_RS16345 (3345684) | 3345684..3346464 | + | 781 | Protein_3182 | helix-turn-helix domain-containing protein | - |
PTZ65_RS16350 (3346466) | 3346466..3347374 | - | 909 | WP_077906523.1 | hypothetical protein | - |
PTZ65_RS16355 (3347647) | 3347647..3347979 | - | 333 | WP_017441352.1 | DUF1493 family protein | - |
PTZ65_RS16360 (3348502) | 3348502..3348618 | - | 117 | Protein_3185 | IS110 family transposase | - |
PTZ65_RS16365 (3348983) | 3348983..3349372 | + | 390 | WP_017441353.1 | hypothetical protein | - |
PTZ65_RS16370 (3349375) | 3349375..3349728 | + | 354 | WP_000418733.1 | hypothetical protein | - |
PTZ65_RS16375 (3350141) | 3350141..3350389 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PTZ65_RS16380 (3350379) | 3350379..3350663 | + | 285 | WP_000221345.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PTZ65_RS16385 (3350834) | 3350834..3351223 | + | 390 | WP_001652798.1 | RidA family protein | - |
PTZ65_RS16390 (3351281) | 3351281..3352354 | - | 1074 | WP_017441355.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
PTZ65_RS16395 (3352547) | 3352547..3353035 | - | 489 | WP_017441356.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
PTZ65_RS16400 (3353080) | 3353080..3354588 | + | 1509 | WP_017441357.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3340935..3357445 | 16510 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11043.79 Da Isoelectric Point: 10.6500
>T272355 WP_000221345.1 NZ_CP117850:3350379-3350663 [Salmonella enterica subsp. enterica serovar Mbandaka]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Y2FFA8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |