Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1992062..1992876 | Replicon | chromosome |
Accession | NZ_CP117850 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F22R |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | A0A3W0Q3Z8 |
Locus tag | PTZ65_RS09745 | Protein ID | WP_017441137.1 |
Coordinates | 1992062..1992589 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | A0A418Z520 |
Locus tag | PTZ65_RS09750 | Protein ID | WP_017441138.1 |
Coordinates | 1992586..1992876 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTZ65_RS09715 (1988435) | 1988435..1988833 | + | 399 | Protein_1886 | cytoplasmic protein | - |
PTZ65_RS09720 (1989024) | 1989024..1989263 | + | 240 | Protein_1887 | hypothetical protein | - |
PTZ65_RS09725 (1989420) | 1989420..1990088 | + | 669 | WP_000445914.1 | hypothetical protein | - |
PTZ65_RS09730 (1990115) | 1990115..1990609 | + | 495 | WP_000424947.1 | hypothetical protein | - |
PTZ65_RS09735 (1990780) | 1990780..1991436 | - | 657 | WP_017441135.1 | protein-serine/threonine phosphatase | - |
PTZ65_RS09740 (1991774) | 1991774..1991989 | + | 216 | Protein_1891 | IS5/IS1182 family transposase | - |
PTZ65_RS09745 (1992062) | 1992062..1992589 | - | 528 | WP_017441137.1 | GNAT family N-acetyltransferase | Toxin |
PTZ65_RS09750 (1992586) | 1992586..1992876 | - | 291 | WP_017441138.1 | DUF1778 domain-containing protein | Antitoxin |
PTZ65_RS09755 (1993146) | 1993146..1993346 | - | 201 | Protein_1894 | IS3 family transposase | - |
PTZ65_RS09760 (1993587) | 1993587..1993913 | + | 327 | WP_000393295.1 | hypothetical protein | - |
PTZ65_RS09765 (1994186) | 1994186..1994533 | - | 348 | WP_001555786.1 | DUF1493 family protein | - |
PTZ65_RS09770 (1994518) | 1994518..1994967 | - | 450 | WP_017441139.1 | hypothetical protein | - |
PTZ65_RS09775 (1995399) | 1995399..1995842 | - | 444 | WP_017441140.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
PTZ65_RS09780 (1996298) | 1996298..1996948 | + | 651 | WP_001728903.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1991849..2002261 | 10412 | |
- | flank | IS/Tn | - | - | 1991849..1991989 | 140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19035.89 Da Isoelectric Point: 9.6420
>T272349 WP_017441137.1 NZ_CP117850:c1992589-1992062 [Salmonella enterica subsp. enterica serovar Mbandaka]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SLKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SLKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10721.55 Da Isoelectric Point: 8.5957
>AT272349 WP_017441138.1 NZ_CP117850:c1992876-1992586 [Salmonella enterica subsp. enterica serovar Mbandaka]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFARPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFARPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3W0Q3Z8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A418Z520 |