Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 1310882..1311673 | Replicon | chromosome |
Accession | NZ_CP117850 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F22R |
Toxin (Protein)
Gene name | ataT | Uniprot ID | C0Q119 |
Locus tag | PTZ65_RS06410 | Protein ID | WP_000369560.1 |
Coordinates | 1311155..1311673 (+) | Length | 173 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | Q57IR1 |
Locus tag | PTZ65_RS06405 | Protein ID | WP_001275017.1 |
Coordinates | 1310882..1311151 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTZ65_RS06385 (1306463) | 1306463..1307131 | + | 669 | WP_000617729.1 | cell division ATP-binding protein FtsE | - |
PTZ65_RS06390 (1307124) | 1307124..1308179 | + | 1056 | WP_001081707.1 | permease-like cell division protein FtsX | - |
PTZ65_RS06395 (1308425) | 1308425..1309279 | + | 855 | WP_000159621.1 | RNA polymerase sigma factor RpoH | - |
PTZ65_RS06400 (1309601) | 1309601..1310704 | + | 1104 | WP_001528146.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
PTZ65_RS06405 (1310882) | 1310882..1311151 | + | 270 | WP_001275017.1 | DUF1778 domain-containing protein | Antitoxin |
PTZ65_RS06410 (1311155) | 1311155..1311673 | + | 519 | WP_000369560.1 | GNAT family N-acetyltransferase | Toxin |
PTZ65_RS06415 (1311670) | 1311670..1312053 | - | 384 | WP_000778873.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
PTZ65_RS06420 (1312475) | 1312475..1313584 | + | 1110 | WP_000822976.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
PTZ65_RS06425 (1313644) | 1313644..1314570 | + | 927 | WP_000003007.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
PTZ65_RS06430 (1314567) | 1314567..1315844 | + | 1278 | WP_000803764.1 | branched chain amino acid ABC transporter permease LivM | - |
PTZ65_RS06435 (1315841) | 1315841..1316608 | + | 768 | WP_000082083.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 173 a.a. Molecular weight: 19414.16 Da Isoelectric Point: 8.9619
>T272345 WP_000369560.1 NZ_CP117850:1311155-1311673 [Salmonella enterica subsp. enterica serovar Mbandaka]
VDNLTIEILADNAEYNWRQFDCGEASLNLFLTQHLQRQHNNKILRGYVLRTTTPERRVLGYYTLSGSCFERASLPSRTQQ
KRIPYQNIPSVTLGRLAVDLSLQGKGWGAILVTHAMKVVWSASLAVGIHGIFVEALNEKAQAFYQRLGFISLSGENEHAL
FYPTKSIEQLFG
VDNLTIEILADNAEYNWRQFDCGEASLNLFLTQHLQRQHNNKILRGYVLRTTTPERRVLGYYTLSGSCFERASLPSRTQQ
KRIPYQNIPSVTLGRLAVDLSLQGKGWGAILVTHAMKVVWSASLAVGIHGIFVEALNEKAQAFYQRLGFISLSGENEHAL
FYPTKSIEQLFG
Download Length: 519 bp
Antitoxin
Download Length: 90 a.a. Molecular weight: 10086.53 Da Isoelectric Point: 7.2056
>AT272345 WP_001275017.1 NZ_CP117850:1310882-1311151 [Salmonella enterica subsp. enterica serovar Mbandaka]
MSALKKQRIDLRLTDGDKSMIEEAAAITNQSITQFMLNSAAERAAEVLEQHRRVILNEASWARVMDALSHPPTPNEKLKR
AAQRLQDME
MSALKKQRIDLRLTDGDKSMIEEAAAITNQSITQFMLNSAAERAAEVLEQHRRVILNEASWARVMDALSHPPTPNEKLKR
AAQRLQDME
Download Length: 270 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5BA59 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I8URP5 |