Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 483379..484160 Replicon chromosome
Accession NZ_CP117850
Organism Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F22R

Toxin (Protein)


Gene name TacT2 Uniprot ID A0A3G3E5T9
Locus tag PTZ65_RS02530 Protein ID WP_000625911.1
Coordinates 483379..483870 (-) Length 164 a.a.

Antitoxin (Protein)


Gene name TacA2 Uniprot ID V7IUD2
Locus tag PTZ65_RS02535 Protein ID WP_001271379.1
Coordinates 483867..484160 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTZ65_RS02500 (478513) 478513..480951 - 2439 WP_017441226.1 F4 (K88) fimbrial usher FaeD -
PTZ65_RS02505 (480961) 480961..481500 - 540 WP_000721295.1 type 1 fimbrial protein -
PTZ65_RS02510 (481535) 481535..481825 - 291 WP_000773469.1 PapB/FocB family fimbrial expression transcriptional regulator -
PTZ65_RS02515 (482413) 482413..482670 + 258 WP_001112996.1 hypothetical protein -
PTZ65_RS02520 (482708) 482708..482887 - 180 WP_150317535.1 hypothetical protein -
PTZ65_RS02525 (482916) 482916..483164 - 249 Protein_496 IS481 family transposase -
PTZ65_RS02530 (483379) 483379..483870 - 492 WP_000625911.1 GNAT family N-acetyltransferase Toxin
PTZ65_RS02535 (483867) 483867..484160 - 294 WP_001271379.1 DUF1778 domain-containing protein Antitoxin
PTZ65_RS02540 (484478) 484478..484699 + 222 WP_001595143.1 hypothetical protein -
PTZ65_RS02545 (484965) 484965..485840 + 876 WP_017441228.1 AraC family transcriptional regulator -
PTZ65_RS02550 (485837) 485837..486124 + 288 WP_072103482.1 transcriptional regulator RtsB -
PTZ65_RS02555 (486131) 486131..486298 - 168 WP_071527476.1 ATP-binding cassette domain-containing protein -
PTZ65_RS02560 (486318) 486318..486417 + 100 Protein_503 hypothetical protein -
PTZ65_RS02565 (486465) 486465..486659 + 195 WP_223195369.1 hypothetical protein -
PTZ65_RS02570 (486953) 486953..487858 - 906 WP_001268200.1 YjiK family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - faeI / faeH / faeF / faeE / faeD / faeC 471769..486124 14355


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(87-144)

Antitoxin

Vibrio phage ICP1, Orf50

(1-95)


Sequences

Toxin        


Download         Length: 164 a.a.        Molecular weight: 17663.44 Da        Isoelectric Point: 7.2655

>T272342 WP_000625911.1 NZ_CP117850:c483870-483379 [Salmonella enterica subsp. enterica serovar Mbandaka]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFEPSPMDPMMLMVTLGDLV
ESV

Download         Length: 492 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 10938.54 Da        Isoelectric Point: 9.8590

>AT272342 WP_001271379.1 NZ_CP117850:c484160-483867 [Salmonella enterica subsp. enterica serovar Mbandaka]
MSAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3G3E5T9

Antitoxin

Source ID Structure
AlphaFold DB V7IUD2

References