Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 297116..297666 Replicon chromosome
Accession NZ_CP117850
Organism Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F22R

Toxin (Protein)


Gene name ccdB Uniprot ID M7RJ32
Locus tag PTZ65_RS01575 Protein ID WP_001199743.1
Coordinates 297116..297424 (-) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V7ITQ8
Locus tag PTZ65_RS01580 Protein ID WP_000016244.1
Coordinates 297427..297666 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTZ65_RS01555 (292451) 292451..293362 + 912 WP_017441175.1 zincin-like metallopeptidase domain-containing protein -
PTZ65_RS01560 (293468) 293468..293923 + 456 WP_031615695.1 NUDIX domain-containing protein -
PTZ65_RS01565 (294214) 294214..295833 + 1620 WP_017441177.1 MobH family relaxase -
PTZ65_RS01570 (295823) 295823..296749 + 927 WP_017441178.1 site-specific integrase -
PTZ65_RS01575 (297116) 297116..297424 - 309 WP_001199743.1 CcdB family protein Toxin
PTZ65_RS01580 (297427) 297427..297666 - 240 WP_000016244.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
PTZ65_RS01585 (297775) 297775..297999 - 225 WP_031233173.1 ribbon-helix-helix protein, CopG family -
PTZ65_RS01590 (298100) 298100..298408 - 309 Protein_314 DUF4942 domain-containing protein -
PTZ65_RS01595 (298428) 298428..299405 - 978 WP_223195356.1 IS630 family transposase -
PTZ65_RS01605 (300163) 300163..301182 + 1020 WP_000152563.1 NAD(P)-dependent alcohol dehydrogenase -
PTZ65_RS01610 (301210) 301210..301740 - 531 WP_017441181.1 gluconokinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 282926..299360 16434
- flank IS/Tn - - 298428..299360 932


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11845.67 Da        Isoelectric Point: 6.7228

>T272340 WP_001199743.1 NZ_CP117850:c297424-297116 [Salmonella enterica subsp. enterica serovar Mbandaka]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8709.86 Da        Isoelectric Point: 6.4633

>AT272340 WP_000016244.1 NZ_CP117850:c297666-297427 [Salmonella enterica subsp. enterica serovar Mbandaka]
MSGMSVRHKKTVSVTLEPALLQQARDAGINLSAVLTAALKEEISATGVERWKAENRAGLQELNRITDEHGLLSDDYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C6Z9V9

Antitoxin

Source ID Structure
AlphaFold DB A0A5I5T4R8

References