Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 297116..297666 | Replicon | chromosome |
| Accession | NZ_CP117850 | ||
| Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F22R | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | M7RJ32 |
| Locus tag | PTZ65_RS01575 | Protein ID | WP_001199743.1 |
| Coordinates | 297116..297424 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | V7ITQ8 |
| Locus tag | PTZ65_RS01580 | Protein ID | WP_000016244.1 |
| Coordinates | 297427..297666 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTZ65_RS01555 (292451) | 292451..293362 | + | 912 | WP_017441175.1 | zincin-like metallopeptidase domain-containing protein | - |
| PTZ65_RS01560 (293468) | 293468..293923 | + | 456 | WP_031615695.1 | NUDIX domain-containing protein | - |
| PTZ65_RS01565 (294214) | 294214..295833 | + | 1620 | WP_017441177.1 | MobH family relaxase | - |
| PTZ65_RS01570 (295823) | 295823..296749 | + | 927 | WP_017441178.1 | site-specific integrase | - |
| PTZ65_RS01575 (297116) | 297116..297424 | - | 309 | WP_001199743.1 | CcdB family protein | Toxin |
| PTZ65_RS01580 (297427) | 297427..297666 | - | 240 | WP_000016244.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| PTZ65_RS01585 (297775) | 297775..297999 | - | 225 | WP_031233173.1 | ribbon-helix-helix protein, CopG family | - |
| PTZ65_RS01590 (298100) | 298100..298408 | - | 309 | Protein_314 | DUF4942 domain-containing protein | - |
| PTZ65_RS01595 (298428) | 298428..299405 | - | 978 | WP_223195356.1 | IS630 family transposase | - |
| PTZ65_RS01605 (300163) | 300163..301182 | + | 1020 | WP_000152563.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| PTZ65_RS01610 (301210) | 301210..301740 | - | 531 | WP_017441181.1 | gluconokinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 282926..299360 | 16434 | |
| - | flank | IS/Tn | - | - | 298428..299360 | 932 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T272340 WP_001199743.1 NZ_CP117850:c297424-297116 [Salmonella enterica subsp. enterica serovar Mbandaka]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I5T4R8 |