Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3811876..3812533 | Replicon | chromosome |
Accession | NZ_CP117838 | ||
Organism | Enterobacter sp. S-33 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A1H8U0Q4 |
Locus tag | PUP35_RS17985 | Protein ID | WP_021242050.1 |
Coordinates | 3811876..3812286 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W7NX65 |
Locus tag | PUP35_RS17990 | Protein ID | WP_006178375.1 |
Coordinates | 3812267..3812533 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP35_RS17965 | 3807869..3809602 | - | 1734 | WP_274240732.1 | single-stranded-DNA-specific exonuclease RecJ | - |
PUP35_RS17970 | 3809608..3810321 | - | 714 | WP_111963201.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PUP35_RS17975 | 3810350..3811246 | - | 897 | WP_111963202.1 | site-specific tyrosine recombinase XerD | - |
PUP35_RS17980 | 3811348..3811869 | + | 522 | WP_008499710.1 | flavodoxin FldB | - |
PUP35_RS17985 | 3811876..3812286 | - | 411 | WP_021242050.1 | protein YgfX | Toxin |
PUP35_RS17990 | 3812267..3812533 | - | 267 | WP_006178375.1 | FAD assembly factor SdhE | Antitoxin |
PUP35_RS17995 | 3812828..3813808 | + | 981 | WP_274240739.1 | tRNA-modifying protein YgfZ | - |
PUP35_RS18000 | 3813919..3814578 | - | 660 | WP_274240741.1 | hemolysin III family protein | - |
PUP35_RS18005 | 3814744..3815055 | - | 312 | WP_223582476.1 | N(4)-acetylcytidine aminohydrolase | - |
PUP35_RS18010 | 3815107..3815838 | + | 732 | WP_032660101.1 | MurR/RpiR family transcriptional regulator | - |
PUP35_RS18015 | 3815955..3817388 | + | 1434 | WP_274240745.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16097.08 Da Isoelectric Point: 10.9468
>T272337 WP_021242050.1 NZ_CP117838:c3812286-3811876 [Enterobacter sp. S-33]
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1H8U0Q4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | W7NX65 |