Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1073539..1074159 | Replicon | chromosome |
| Accession | NZ_CP117838 | ||
| Organism | Enterobacter sp. S-33 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A1H8SI38 |
| Locus tag | PUP35_RS04990 | Protein ID | WP_008499287.1 |
| Coordinates | 1073539..1073757 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V3PBI9 |
| Locus tag | PUP35_RS04995 | Protein ID | WP_008499288.1 |
| Coordinates | 1073785..1074159 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP35_RS04960 | 1069554..1069814 | + | 261 | WP_274242237.1 | type B 50S ribosomal protein L31 | - |
| PUP35_RS04965 | 1069817..1069957 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| PUP35_RS04970 | 1069954..1070664 | - | 711 | WP_133293898.1 | GNAT family protein | - |
| PUP35_RS04975 | 1070766..1072226 | + | 1461 | WP_274242238.1 | PLP-dependent aminotransferase family protein | - |
| PUP35_RS04980 | 1072198..1072665 | - | 468 | WP_023310598.1 | YlaC family protein | - |
| PUP35_RS04985 | 1072783..1073334 | - | 552 | WP_023310599.1 | maltose O-acetyltransferase | - |
| PUP35_RS04990 | 1073539..1073757 | - | 219 | WP_008499287.1 | HHA domain-containing protein | Toxin |
| PUP35_RS04995 | 1073785..1074159 | - | 375 | WP_008499288.1 | Hha toxicity modulator TomB | Antitoxin |
| PUP35_RS05000 | 1074670..1077816 | - | 3147 | WP_029741964.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| PUP35_RS05005 | 1077839..1079032 | - | 1194 | WP_115874373.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8612.00 Da Isoelectric Point: 8.9008
>T272329 WP_008499287.1 NZ_CP117838:c1073757-1073539 [Enterobacter sp. S-33]
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14481.28 Da Isoelectric Point: 4.8886
>AT272329 WP_008499288.1 NZ_CP117838:c1074159-1073785 [Enterobacter sp. S-33]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1H8SI38 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V3PBI9 |