Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 930358..931073 | Replicon | chromosome |
Accession | NZ_CP117838 | ||
Organism | Enterobacter sp. S-33 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | PUP35_RS04345 | Protein ID | WP_274242181.1 |
Coordinates | 930705..931073 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | PUP35_RS04340 | Protein ID | WP_274242180.1 |
Coordinates | 930358..930684 (+) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP35_RS04315 | 926226..927116 | + | 891 | WP_274242175.1 | 50S ribosome-binding GTPase | - |
PUP35_RS04320 | 927422..927973 | + | 552 | WP_274242176.1 | hypothetical protein | - |
PUP35_RS04325 | 927979..928605 | + | 627 | WP_274242177.1 | hypothetical protein | - |
PUP35_RS04330 | 928987..929805 | + | 819 | WP_274242178.1 | DUF932 domain-containing protein | - |
PUP35_RS04335 | 929875..930345 | + | 471 | WP_274242179.1 | DNA repair protein RadC | - |
PUP35_RS04340 | 930358..930684 | + | 327 | WP_274242180.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
PUP35_RS04345 | 930705..931073 | + | 369 | WP_274242181.1 | TA system toxin CbtA family protein | Toxin |
PUP35_RS04350 | 931757..934066 | + | 2310 | WP_274242182.1 | TerB N-terminal domain-containing protein | - |
PUP35_RS04355 | 934070..935386 | + | 1317 | WP_166876384.1 | ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 909802..950126 | 40324 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13797.22 Da Isoelectric Point: 9.5668
>T272328 WP_274242181.1 NZ_CP117838:930705-931073 [Enterobacter sp. S-33]
MKFLPATNMRAAKPCLTPVTIWQMLLTRLLKQHYGLMLSDTPFSDEAVIKEHIDAGITLANAVNFLVEKYELVRIDRNGF
TSQLQAPYLTATDILHARKACGLMARCSYREVSNIVLSRSRL
MKFLPATNMRAAKPCLTPVTIWQMLLTRLLKQHYGLMLSDTPFSDEAVIKEHIDAGITLANAVNFLVEKYELVRIDRNGF
TSQLQAPYLTATDILHARKACGLMARCSYREVSNIVLSRSRL
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|