Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pemIK/MazF(toxin)
Location 247368..248006 Replicon chromosome
Accession NZ_CP117835
Organism Alkalihalophilus pseudofirmus strain DSM 8715

Toxin (Protein)


Gene name pemK Uniprot ID U6SMK3
Locus tag PQ478_RS01335 Protein ID WP_012957256.1
Coordinates 247656..248006 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name pemI Uniprot ID -
Locus tag PQ478_RS01330 Protein ID WP_031311629.1
Coordinates 247368..247652 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQ478_RS01300 (PQ478_01300) 242574..242891 + 318 WP_289235586.1 DUF2325 domain-containing protein -
PQ478_RS01305 (PQ478_01305) 242914..243477 + 564 WP_289235587.1 hypothetical protein -
PQ478_RS01310 (PQ478_01310) 243767..244669 + 903 WP_289236922.1 zinc ABC transporter substrate-binding protein -
PQ478_RS01315 (PQ478_01315) 244716..245456 - 741 WP_012957252.1 rhomboid family intramembrane serine protease -
PQ478_RS01320 (PQ478_01320) 245558..245917 + 360 WP_289235588.1 holo-ACP synthase -
PQ478_RS01325 (PQ478_01325) 246156..247166 + 1011 WP_012957254.1 outer membrane lipoprotein carrier protein LolA -
PQ478_RS01330 (PQ478_01330) 247368..247652 + 285 WP_031311629.1 hypothetical protein Antitoxin
PQ478_RS01335 (PQ478_01335) 247656..248006 + 351 WP_012957256.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
PQ478_RS01340 (PQ478_01340) 248252..249070 + 819 WP_075683769.1 RsbT co-antagonist protein RsbRA -
PQ478_RS01345 (PQ478_01345) 249087..249443 + 357 WP_012957258.1 STAS domain-containing protein -
PQ478_RS01350 (PQ478_01350) 249446..249859 + 414 WP_012957259.1 anti-sigma regulatory factor -
PQ478_RS01355 (PQ478_01355) 249872..250885 + 1014 WP_012957260.1 PP2C family protein-serine/threonine phosphatase -
PQ478_RS01360 (PQ478_01360) 250947..251279 + 333 WP_012957261.1 STAS domain-containing protein -
PQ478_RS01365 (PQ478_01365) 251276..251764 + 489 WP_012957262.1 anti-sigma B factor RsbW -
PQ478_RS01370 (PQ478_01370) 251724..252509 + 786 WP_012957263.1 RNA polymerase sigma factor SigB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(4-109)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 12981.03 Da        Isoelectric Point: 6.4662

>T272327 WP_012957256.1 NZ_CP117835:247656-248006 [Alkalihalophilus pseudofirmus]
MIVKRGDVYFADLSPVVGSEQGGVRPVLIIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKRYGFDRDSVILLEQV
RTIDKQRLTDKITHLDDDMMTRVNDALFISLGLIDF

Download         Length: 351 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10959.48 Da        Isoelectric Point: 5.1667

>AT272327 WP_031311629.1 NZ_CP117835:247368-247652 [Alkalihalophilus pseudofirmus]
MFVSEQRTKRIVVNLPQHLLNEVDGVIQQENVNYSEFLSQATKLYLRDRKKRQIRETMQQGYMEMAKINLNLASEAFLAE
EEAENTLDRLVSGV

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U6SMK3

Antitoxin

Source ID Structure

References