Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 247368..248006 | Replicon | chromosome |
| Accession | NZ_CP117835 | ||
| Organism | Alkalihalophilus pseudofirmus strain DSM 8715 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | U6SMK3 |
| Locus tag | PQ478_RS01335 | Protein ID | WP_012957256.1 |
| Coordinates | 247656..248006 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | PQ478_RS01330 | Protein ID | WP_031311629.1 |
| Coordinates | 247368..247652 (+) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQ478_RS01300 (PQ478_01300) | 242574..242891 | + | 318 | WP_289235586.1 | DUF2325 domain-containing protein | - |
| PQ478_RS01305 (PQ478_01305) | 242914..243477 | + | 564 | WP_289235587.1 | hypothetical protein | - |
| PQ478_RS01310 (PQ478_01310) | 243767..244669 | + | 903 | WP_289236922.1 | zinc ABC transporter substrate-binding protein | - |
| PQ478_RS01315 (PQ478_01315) | 244716..245456 | - | 741 | WP_012957252.1 | rhomboid family intramembrane serine protease | - |
| PQ478_RS01320 (PQ478_01320) | 245558..245917 | + | 360 | WP_289235588.1 | holo-ACP synthase | - |
| PQ478_RS01325 (PQ478_01325) | 246156..247166 | + | 1011 | WP_012957254.1 | outer membrane lipoprotein carrier protein LolA | - |
| PQ478_RS01330 (PQ478_01330) | 247368..247652 | + | 285 | WP_031311629.1 | hypothetical protein | Antitoxin |
| PQ478_RS01335 (PQ478_01335) | 247656..248006 | + | 351 | WP_012957256.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PQ478_RS01340 (PQ478_01340) | 248252..249070 | + | 819 | WP_075683769.1 | RsbT co-antagonist protein RsbRA | - |
| PQ478_RS01345 (PQ478_01345) | 249087..249443 | + | 357 | WP_012957258.1 | STAS domain-containing protein | - |
| PQ478_RS01350 (PQ478_01350) | 249446..249859 | + | 414 | WP_012957259.1 | anti-sigma regulatory factor | - |
| PQ478_RS01355 (PQ478_01355) | 249872..250885 | + | 1014 | WP_012957260.1 | PP2C family protein-serine/threonine phosphatase | - |
| PQ478_RS01360 (PQ478_01360) | 250947..251279 | + | 333 | WP_012957261.1 | STAS domain-containing protein | - |
| PQ478_RS01365 (PQ478_01365) | 251276..251764 | + | 489 | WP_012957262.1 | anti-sigma B factor RsbW | - |
| PQ478_RS01370 (PQ478_01370) | 251724..252509 | + | 786 | WP_012957263.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12981.03 Da Isoelectric Point: 6.4662
>T272327 WP_012957256.1 NZ_CP117835:247656-248006 [Alkalihalophilus pseudofirmus]
MIVKRGDVYFADLSPVVGSEQGGVRPVLIIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKRYGFDRDSVILLEQV
RTIDKQRLTDKITHLDDDMMTRVNDALFISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLIIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKRYGFDRDSVILLEQV
RTIDKQRLTDKITHLDDDMMTRVNDALFISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|