Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pemIK/MazF(toxin)
Location 690521..691081 Replicon chromosome
Accession NZ_CP117834
Organism Shouchella hunanensis strain DSM 23008

Toxin (Protein)


Gene name pemK Uniprot ID A0A060M172
Locus tag PQ477_RS03770 Protein ID WP_035398813.1
Coordinates 690521..690871 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name pemI Uniprot ID -
Locus tag PQ477_RS03775 Protein ID WP_206698938.1
Coordinates 690875..691081 (-) Length 69 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQ477_RS03735 (PQ477_03735) 686109..686894 - 786 WP_144559690.1 RNA polymerase sigma factor SigB -
PQ477_RS03740 (PQ477_03740) 686860..687339 - 480 WP_035398802.1 anti-sigma B factor RsbW -
PQ477_RS03745 (PQ477_03745) 687336..687662 - 327 WP_035398804.1 STAS domain-containing protein -
PQ477_RS03750 (PQ477_03750) 687729..688745 - 1017 WP_035398806.1 PP2C family protein-serine/threonine phosphatase -
PQ477_RS03755 (PQ477_03755) 688758..689174 - 417 WP_035398808.1 anti-sigma regulatory factor -
PQ477_RS03760 (PQ477_03760) 689177..689533 - 357 WP_035398810.1 STAS domain-containing protein -
PQ477_RS03765 (PQ477_03765) 689552..690370 - 819 WP_274272976.1 STAS domain-containing protein -
PQ477_RS03770 (PQ477_03770) 690521..690871 - 351 WP_035398813.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
PQ477_RS03775 (PQ477_03775) 690875..691081 - 207 WP_206698938.1 antitoxin Antitoxin
PQ477_RS03780 (PQ477_03780) 691382..692404 - 1023 WP_274272977.1 outer membrane lipoprotein carrier protein LolA -
PQ477_RS03785 (PQ477_03785) 692520..692882 - 363 WP_035398705.1 holo-ACP synthase -
PQ477_RS03790 (PQ477_03790) 692976..693728 + 753 WP_144559694.1 rhomboid family intramembrane serine protease -
PQ477_RS03795 (PQ477_03795) 693826..694437 + 612 WP_246117062.1 YitT family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(1-113)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 12877.99 Da        Isoelectric Point: 8.5490

>T272326 WP_035398813.1 NZ_CP117834:c690871-690521 [Shouchella hunanensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLIIQNNIGNRFSPTVIVAAITAQIQKAKLPTHVEINASKYGFDRDSVILLEQL
RTIDKQRLTDKITHLDEKMMQSVDKALTISLGLIDF

Download         Length: 351 bp

Antitoxin


Download         Length: 69 a.a.        Molecular weight: 7834.89 Da        Isoelectric Point: 4.3351

>AT272326 WP_206698938.1 NZ_CP117834:c691081-690875 [Shouchella hunanensis]
MNEVDIVLEQEKWNDPRLKDRAELKAEIRESMQQGYMEMAKINLTIASEAFLAEEEANHTLTRLVSGV

Download         Length: 207 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A060M172

Antitoxin

Source ID Structure

References