Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higB-toxA/Tad-HTH_37 |
| Location | 603817..604462 | Replicon | chromosome |
| Accession | NZ_CP117825 | ||
| Organism | Fusobacterium nucleatum strain FNP | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PSC67_RS03165 | Protein ID | WP_274180693.1 |
| Coordinates | 603817..604185 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | toxA | Uniprot ID | - |
| Locus tag | PSC67_RS03170 | Protein ID | WP_274180694.1 |
| Coordinates | 604175..604462 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PSC67_RS03145 (PSC67_03145) | 600164..600670 | - | 507 | WP_274180689.1 | hypothetical protein | - |
| PSC67_RS03150 (PSC67_03150) | 600949..602124 | + | 1176 | WP_274180690.1 | IS110 family transposase | - |
| PSC67_RS03155 (PSC67_03155) | 602364..603485 | + | 1122 | WP_274180691.1 | hypothetical protein | - |
| PSC67_RS03160 (PSC67_03160) | 603518..603691 | + | 174 | WP_274180692.1 | hypothetical protein | - |
| PSC67_RS03165 (PSC67_03165) | 603817..604185 | + | 369 | WP_274180693.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PSC67_RS03170 (PSC67_03170) | 604175..604462 | + | 288 | WP_274180694.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| PSC67_RS03175 (PSC67_03175) | 604485..604805 | + | 321 | WP_274180695.1 | nucleotidyltransferase domain-containing protein | - |
| PSC67_RS03180 (PSC67_03180) | 604798..605187 | + | 390 | WP_098979686.1 | DUF86 domain-containing protein | - |
| PSC67_RS03185 (PSC67_03185) | 605205..605504 | + | 300 | WP_274180696.1 | STAS-like domain-containing protein | - |
| PSC67_RS03190 (PSC67_03190) | 605554..605874 | + | 321 | WP_098979687.1 | nucleotidyltransferase domain-containing protein | - |
| PSC67_RS03195 (PSC67_03195) | 605939..606157 | + | 219 | WP_274180697.1 | DUF6290 family protein | - |
| PSC67_RS03200 (PSC67_03200) | 606197..606739 | - | 543 | WP_274180698.1 | hypothetical protein | - |
| PSC67_RS03205 (PSC67_03205) | 606766..607272 | - | 507 | WP_274180699.1 | HAD family hydrolase | - |
| PSC67_RS03210 (PSC67_03210) | 607282..607854 | - | 573 | WP_274180700.1 | crossover junction endodeoxyribonuclease RuvC | - |
| PSC67_RS03215 (PSC67_03215) | 607854..608606 | - | 753 | WP_032847258.1 | MgtC/SapB family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 14781.33 Da Isoelectric Point: 10.3677
>T272324 WP_274180693.1 NZ_CP117825:603817-604185 [Fusobacterium nucleatum]
MYKVGFYLKNGKSDIIEYLDKLKIKSEKSKEARIIRNKILSYIKSLELYGTRVGEPIVKHIEDDIWELRPLNNRIFFFYF
KDNKFILLHYFIKKTNKTPKKEIEEARNRMNDFIARSDKNVK
MYKVGFYLKNGKSDIIEYLDKLKIKSEKSKEARIIRNKILSYIKSLELYGTRVGEPIVKHIEDDIWELRPLNNRIFFFYF
KDNKFILLHYFIKKTNKTPKKEIEEARNRMNDFIARSDKNVK
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|