Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 61915..62403 Replicon chromosome
Accession NZ_CP117825
Organism Fusobacterium nucleatum strain FNP

Toxin (Protein)


Gene name relE Uniprot ID X7RWI8
Locus tag PSC67_RS00305 Protein ID WP_032890330.1
Coordinates 62140..62403 (+) Length 88 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID X8HUL4
Locus tag PSC67_RS00300 Protein ID WP_023038160.1
Coordinates 61915..62139 (+) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PSC67_RS00280 (PSC67_00280) 57364..58431 - 1068 WP_005901019.1 NCS2 family permease -
PSC67_RS00285 (PSC67_00285) 58683..58850 + 168 WP_274180377.1 hypothetical protein -
PSC67_RS00290 (PSC67_00290) 58889..60364 + 1476 WP_274180378.1 cobyric acid synthase -
PSC67_RS00295 (PSC67_00295) 60490..61845 + 1356 WP_274180379.1 sodium:alanine symporter family protein -
PSC67_RS00300 (PSC67_00300) 61915..62139 + 225 WP_023038160.1 DUF6290 family protein Antitoxin
PSC67_RS00305 (PSC67_00305) 62140..62403 + 264 WP_032890330.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PSC67_RS00310 (PSC67_00310) 62469..63926 + 1458 WP_274180380.1 HD domain-containing protein -
PSC67_RS00315 (PSC67_00315) 63948..64487 + 540 WP_274180381.1 TlpA disulfide reductase family protein -
PSC67_RS00320 (PSC67_00320) 64520..64945 - 426 WP_032890325.1 ImmA/IrrE family metallo-endopeptidase -
PSC67_RS00325 (PSC67_00325) 64896..65363 - 468 WP_005901035.1 helix-turn-helix domain-containing protein -
PSC67_RS00330 (PSC67_00330) 65552..66055 + 504 WP_274180382.1 hypothetical protein -
PSC67_RS00335 (PSC67_00335) 66207..66611 + 405 WP_098974968.1 adhesion protein FadA -
PSC67_RS00340 (PSC67_00340) 66625..67170 + 546 WP_274180383.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin

Protein of unknown function DUF6290

(1-72)


Sequences

Toxin        


Download         Length: 88 a.a.        Molecular weight: 10588.47 Da        Isoelectric Point: 9.8829

>T272322 WP_032890330.1 NZ_CP117825:62140-62403 [Fusobacterium nucleatum]
MYKVYFDKKVEKDFKKLDKKVLKLILDWIENNLENIEEPRSKGKALVGNLKDYWRYRIGDYRLITKIDDGKLLIIALELK
HRKEVYE

Download         Length: 264 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8713.05 Da        Isoelectric Point: 5.8834

>AT272322 WP_023038160.1 NZ_CP117825:61915-62139 [Fusobacterium nucleatum]
MSNITLRLTDEEREILNNVAHLYGDKLSTAIKTILFEKIEEDYNLKIVKDFEKREKENKVELVSLSDFRKKLGV

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB X7RWI8

Antitoxin

Source ID Structure
AlphaFold DB X8HUL4

References