Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) shpAB/BrnT-BrnA
Location 35881..36463 Replicon plasmid unnamed
Accession NZ_CP117824
Organism Xylella fastidiosa strain ICMP 8742

Toxin (Protein)


Gene name shpA Uniprot ID A0A060HA48
Locus tag PUO95_RS11760 Protein ID WP_038229226.1
Coordinates 36173..36463 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name shpB Uniprot ID A0A060HE88
Locus tag PUO95_RS11755 Protein ID WP_004091409.1
Coordinates 35881..36186 (-) Length 102 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUO95_RS11725 (PUO95_11725) 32430..32855 + 426 WP_004091423.1 antirestriction protein -
PUO95_RS11730 (PUO95_11730) 33123..33380 + 258 WP_038229233.1 hypothetical protein -
PUO95_RS11735 (PUO95_11735) 33574..34206 - 633 WP_004091419.1 YkgJ family cysteine cluster protein -
PUO95_RS11740 (PUO95_11740) 34327..34884 - 558 WP_004091417.1 recombinase family protein -
PUO95_RS11745 (PUO95_11745) 35074..35448 - 375 WP_010894485.1 DUF5615 family PIN-like protein -
PUO95_RS11750 (PUO95_11750) 35445..35675 - 231 WP_004091411.1 DUF433 domain-containing protein -
PUO95_RS11755 (PUO95_11755) 35881..36186 - 306 WP_004091409.1 BrnA antitoxin family protein Antitoxin
PUO95_RS11760 (PUO95_11760) 36173..36463 - 291 WP_038229226.1 BrnT family toxin Toxin
PUO95_RS11765 (PUO95_11765) 36640..36813 + 174 Protein_41 XRE family transcriptional regulator -
PUO95_RS11770 (PUO95_11770) 36924..37244 + 321 WP_004091397.1 type II toxin-antitoxin system RelE/ParE family toxin -
PUO95_RS11775 (PUO95_11775) 37374..37700 + 327 WP_004091396.1 DNA-binding protein -
PUO95_RS11780 (PUO95_11780) 37842..38768 - 927 WP_051606204.1 hypothetical protein -
PUO95_RS11785 (PUO95_11785) 39174..39590 - 417 WP_038232460.1 IS200/IS605 family transposase -
PUO95_RS11790 (PUO95_11790) 39613..40770 + 1158 WP_038232468.1 RNA-guided endonuclease TnpB family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..41752 41752
- inside IScluster/Tn - - 34327..40770 6443


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

(7-89)

Antitoxin

BrnA antitoxin of type II toxin-antitoxin system

(11-93)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11304.62 Da        Isoelectric Point: 6.0917

>T272321 WP_038229226.1 NZ_CP117824:c36463-36173 [Xylella fastidiosa]
VERYFEWDDKKAESNFRKHGIRFDEAALAFDDPFAVSEQNRIENGEQRWQTIGMAGGCLLLLVAHTVHFEDDGIEVVRII
SARRVDRKERRRYEHG

Download         Length: 291 bp

Antitoxin


Download         Length: 102 a.a.        Molecular weight: 11684.43 Da        Isoelectric Point: 9.4870

>AT272321 WP_004091409.1 NZ_CP117824:c36186-35881 [Xylella fastidiosa]
MNMVRYKQSELPPLTEERKAELKALAKKPDSEIDYSDIPPLDESFWARAVPNPFFKPVKTHASVRIDSDVLAWLKSQGKG
YQTRMNAILREAMLRSLHQQE

Download         Length: 306 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A060HA48

Antitoxin

Source ID Structure
AlphaFold DB A0A060HE88

References