Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
Location | 2528754..2529365 | Replicon | chromosome |
Accession | NZ_CP117823 | ||
Organism | Xylella fastidiosa strain ICMP 8742 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q879T9 |
Locus tag | PUO95_RS11450 | Protein ID | WP_011098375.1 |
Coordinates | 2529066..2529365 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q879U0 |
Locus tag | PUO95_RS11445 | Protein ID | WP_004085003.1 |
Coordinates | 2528754..2529062 (-) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUO95_RS11415 (PUO95_11415) | 2525324..2526085 | - | 762 | WP_004090267.1 | Bax inhibitor-1/YccA family protein | - |
PUO95_RS11440 (PUO95_11440) | 2527277..2528680 | + | 1404 | WP_274265325.1 | hypothetical protein | - |
PUO95_RS11445 (PUO95_11445) | 2528754..2529062 | - | 309 | WP_004085003.1 | putative addiction module antidote protein | Antitoxin |
PUO95_RS11450 (PUO95_11450) | 2529066..2529365 | - | 300 | WP_011098375.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUO95_RS11455 (PUO95_11455) | 2529453..2529986 | + | 534 | WP_225621759.1 | hypothetical protein | - |
PUO95_RS11460 (PUO95_11460) | 2530009..2530152 | + | 144 | WP_155115087.1 | hypothetical protein | - |
PUO95_RS11465 (PUO95_11465) | 2530305..2530685 | - | 381 | WP_004089371.1 | DUF596 domain-containing protein | - |
PUO95_RS11470 (PUO95_11470) | 2530690..2531820 | - | 1131 | WP_012382788.1 | DUF769 domain-containing protein | - |
PUO95_RS11475 (PUO95_11475) | 2532128..2532508 | - | 381 | WP_004087391.1 | DUF596 domain-containing protein | - |
PUO95_RS11480 (PUO95_11480) | 2532520..2533881 | - | 1362 | WP_272819646.1 | hemagglutinin | - |
PUO95_RS11485 (PUO95_11485) | 2533961..2534104 | + | 144 | WP_155115088.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2479626..2529815 | 50189 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11378.17 Da Isoelectric Point: 10.3861
>T272320 WP_011098375.1 NZ_CP117823:c2529365-2529066 [Xylella fastidiosa]
MTYTLKRLEGFSDWLKGLKDGLARQRLIKRLRKVQLGNFGDVQPVGEGVFEMREHFGPGWRMYYVQRGSFLIVMLGGGDK
STQQSDIRRAIELAKSLED
MTYTLKRLEGFSDWLKGLKDGLARQRLIKRLRKVQLGNFGDVQPVGEGVFEMREHFGPGWRMYYVQRGSFLIVMLGGGDK
STQQSDIRRAIELAKSLED
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q879T9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060HCD4 |