272318

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) FicTA/Fic(toxin)
Location 1928897..1929693 Replicon chromosome
Accession NZ_CP117823
Organism Xylella fastidiosa strain ICMP 8742

Toxin (Protein)


Gene name VbhT Uniprot ID Q87CQ8
Locus tag PUO95_RS08715 Protein ID WP_004088112.1
Coordinates 1928897..1929508 (-) Length 204 a.a.

Antitoxin (Protein)


Gene name VbhA Uniprot ID B2I551
Locus tag PUO95_RS08720 Protein ID WP_004088114.1
Coordinates 1929505..1929693 (-) Length 63 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUO95_RS08670 (PUO95_08670) 1924352..1925239 - 888 WP_012382597.1 YdaU family protein -
PUO95_RS08675 (PUO95_08675) 1925236..1926024 - 789 WP_011097897.1 Bro-N domain-containing protein -
PUO95_RS08680 (PUO95_08680) 1926021..1926653 - 633 WP_004088094.1 Bro-N domain-containing protein -
PUO95_RS08685 (PUO95_08685) 1926650..1926913 - 264 WP_228446177.1 hypothetical protein -
PUO95_RS08690 (PUO95_08690) 1926931..1927146 - 216 WP_012382598.1 hypothetical protein -
PUO95_RS08695 (PUO95_08695) 1927176..1927364 - 189 WP_004088102.1 hypothetical protein -
PUO95_RS08700 (PUO95_08700) 1927392..1927583 - 192 WP_004088104.1 hypothetical protein -
PUO95_RS08705 (PUO95_08705) 1927842..1928087 - 246 WP_004088108.1 hypothetical protein -
PUO95_RS08710 (PUO95_08710) 1928172..1928846 + 675 WP_004088110.1 helix-turn-helix transcriptional regulator -
PUO95_RS08715 (PUO95_08715) 1928897..1929508 - 612 WP_004088112.1 Fic/DOC family protein Toxin
PUO95_RS08720 (PUO95_08720) 1929505..1929693 - 189 WP_004088114.1 antitoxin VbhA family protein Antitoxin
PUO95_RS08725 (PUO95_08725) 1930085..1930621 + 537 WP_038233020.1 hypothetical protein -
PUO95_RS08730 (PUO95_08730) 1930618..1931031 + 414 WP_004088056.1 DUF1566 domain-containing protein -
PUO95_RS08735 (PUO95_08735) 1931028..1931429 + 402 WP_004088054.1 hypothetical protein -
PUO95_RS08740 (PUO95_08740) 1931426..1931575 + 150 WP_012382602.1 hypothetical protein -
PUO95_RS08745 (PUO95_08745) 1931793..1931939 + 147 WP_225621633.1 hypothetical protein -
PUO95_RS08750 (PUO95_08750) 1931962..1932153 + 192 WP_012382603.1 hypothetical protein -
PUO95_RS08755 (PUO95_08755) 1932174..1932518 + 345 WP_004088346.1 hypothetical protein -
PUO95_RS08760 (PUO95_08760) 1932558..1933379 + 822 WP_004088345.1 DUF2303 family protein -
PUO95_RS08765 (PUO95_08765) 1933395..1934321 + 927 WP_004088344.1 phage recombination protein Bet -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1898391..1939443 41052


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(55-152)

Antitoxin

Antitoxin VbhA

(10-56)


Sequences

Toxin        


Download         Length: 204 a.a.        Molecular weight: 22832.60 Da        Isoelectric Point: 5.1271

>T272318 WP_004088112.1 NZ_CP117823:c1929508-1928897 [Xylella fastidiosa]
MKYAGDRGDPYLDSETGVLRNLLGIRDQGGLDKIESTLSFLRTSELRERPVKGKFDLAHLQEIHNRLFQDVYDWAGQIRQ
VEISKGNTMFAQQIAIQSAAQQIFGQLAKERFLCGLDAEEFSKRAGDYLGEINVLHPFREGNGRTQREFIAQLAQRAGYR
IDWGVVSQADMIKASIDAYNGDSSGLASIIREGISDQLFKDNE

Download         Length: 612 bp

Antitoxin


Download         Length: 63 a.a.        Molecular weight: 6837.77 Da        Isoelectric Point: 4.9859

>AT272318 WP_004088114.1 NZ_CP117823:c1929693-1929505 [Xylella fastidiosa]
MLTDHEKAERRAVVQSALASQRIEGLEPDAQAVVDAECWARGEMTIAAAVDQYKARVRLQIA

Download         Length: 189 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q87CQ8

Antitoxin

Source ID Structure
AlphaFold DB B2I551

References