Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pasABC/RelE-HTH
Location 1415710..1416187 Replicon chromosome
Accession NZ_CP117823
Organism Xylella fastidiosa strain ICMP 8742

Toxin (Protein)


Gene name pasB Uniprot ID Q87CA4
Locus tag PUO95_RS06210 Protein ID WP_011097988.1
Coordinates 1415710..1415976 (-) Length 89 a.a.

Antitoxin (Protein)


Gene name pasA Uniprot ID A0A7G7TPD2
Locus tag PUO95_RS06215 Protein ID WP_004091377.1
Coordinates 1415960..1416187 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUO95_RS06170 (PUO95_06170) 1410742..1411347 + 606 Protein_1196 IS607 family transposase -
PUO95_RS06175 (PUO95_06175) 1411341..1411502 + 162 WP_014607806.1 helix-turn-helix domain-containing protein -
PUO95_RS06180 (PUO95_06180) 1411668..1412546 + 879 WP_012382645.1 RNA-guided endonuclease TnpB family protein -
PUO95_RS06185 (PUO95_06185) 1412563..1412796 + 234 WP_038233091.1 DUF3383 family protein -
PUO95_RS06190 (PUO95_06190) 1412806..1413243 + 438 WP_004087249.1 DUF3277 family protein -
PUO95_RS06195 (PUO95_06195) 1413240..1413662 + 423 WP_274265303.1 putative phage tail assembly chaperone -
PUO95_RS06200 (PUO95_06200) 1413689..1413853 + 165 WP_162849007.1 hypothetical protein -
PUO95_RS06205 (PUO95_06205) 1413912..1415699 + 1788 WP_243857829.1 phage tail tape measure protein -
PUO95_RS06210 (PUO95_06210) 1415710..1415976 - 267 WP_011097988.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PUO95_RS06215 (PUO95_06215) 1415960..1416187 - 228 WP_004091377.1 DUF6290 family protein Antitoxin
PUO95_RS06220 (PUO95_06220) 1416298..1417068 + 771 WP_004090769.1 hypothetical protein -
PUO95_RS06225 (PUO95_06225) 1417068..1417385 + 318 WP_011097873.1 hypothetical protein -
PUO95_RS06230 (PUO95_06230) 1417382..1418212 + 831 WP_004090766.1 hypothetical protein -
PUO95_RS06235 (PUO95_06235) 1418209..1418850 + 642 WP_004090764.1 Gp138 family membrane-puncturing spike protein -
PUO95_RS06240 (PUO95_06240) 1418847..1419200 + 354 WP_011097986.1 hypothetical protein -
PUO95_RS06245 (PUO95_06245) 1419211..1419516 - 306 WP_004089254.1 putative addiction module antidote protein -
PUO95_RS06250 (PUO95_06250) 1419520..1419816 - 297 WP_004089252.1 type II toxin-antitoxin system RelE/ParE family toxin -
PUO95_RS06255 (PUO95_06255) 1419915..1420799 + 885 WP_236641892.1 baseplate J/gp47 family protein -
PUO95_RS06260 (PUO95_06260) 1420850..1421050 + 201 WP_236641891.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1412806..1421607 8801
- flank IS/Tn - - 1411126..1411347 221


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10163.79 Da        Isoelectric Point: 10.6086

>T272316 WP_011097988.1 NZ_CP117823:c1415976-1415710 [Xylella fastidiosa]
MAWTIDYTDTAKQQLRKLDKHMARRIVDFMDERIAGLENPRSSGKALTGPLGGFWRYRVGDFRVVCAIQDSVLRVLVVRV
GHRGEIYR

Download         Length: 267 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8615.63 Da        Isoelectric Point: 5.0958

>AT272316 WP_004091377.1 NZ_CP117823:c1416187-1415960 [Xylella fastidiosa]
MATSIRLSPEMEQRLNSLASHTGRTKAYYLREIIEHGIEEMEDYYLAADVLERVRHGQEQVHSAADVRKTLGLDD

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A060HDH1

Antitoxin

Source ID Structure
AlphaFold DB A0A7G7TPD2

References