Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 1222784..1223370 Replicon chromosome
Accession NZ_CP117823
Organism Xylella fastidiosa strain ICMP 8742

Toxin (Protein)


Gene name hicA Uniprot ID Q87BV5
Locus tag PUO95_RS05315 Protein ID WP_004089517.1
Coordinates 1222784..1223038 (+) Length 85 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID B2I6C9
Locus tag PUO95_RS05320 Protein ID WP_004085025.1
Coordinates 1223035..1223370 (+) Length 112 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUO95_RS05280 (PUO95_05280) 1218287..1218892 - 606 WP_004091108.1 conjugal transfer protein TrbN -
PUO95_RS05285 (PUO95_05285) 1218898..1219272 - 375 WP_004091110.1 conjugal transfer protein -
PUO95_RS05290 (PUO95_05290) 1219419..1219673 + 255 WP_012382666.1 hypothetical protein -
PUO95_RS05295 (PUO95_05295) 1219670..1220776 + 1107 WP_012382665.1 YdaU family protein -
PUO95_RS05300 (PUO95_05300) 1220757..1221446 + 690 WP_011098061.1 hypothetical protein -
PUO95_RS05305 (PUO95_05305) 1221443..1221904 + 462 WP_011098060.1 hypothetical protein -
PUO95_RS05310 (PUO95_05310) 1222033..1222731 + 699 WP_011098059.1 hypothetical protein -
PUO95_RS05315 (PUO95_05315) 1222784..1223038 + 255 WP_004089517.1 type II toxin-antitoxin system HicA family toxin Toxin
PUO95_RS05320 (PUO95_05320) 1223035..1223370 + 336 WP_004085025.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
PUO95_RS05325 (PUO95_05325) 1223550..1223849 - 300 WP_004089519.1 HigA family addiction module antitoxin -
PUO95_RS05330 (PUO95_05330) 1223859..1224140 - 282 WP_011098058.1 type II toxin-antitoxin system RelE/ParE family toxin -
PUO95_RS05335 (PUO95_05335) 1224491..1225204 + 714 WP_011098057.1 site-specific DNA-methyltransferase -
PUO95_RS05340 (PUO95_05340) 1225191..1225655 - 465 WP_011098056.1 low molecular weight protein-tyrosine-phosphatase -
PUO95_RS05345 (PUO95_05345) 1225652..1226425 - 774 WP_004089528.1 3-deoxy-manno-octulosonate cytidylyltransferase -
PUO95_RS05350 (PUO95_05350) 1226860..1227771 + 912 WP_004089529.1 iron-sulfur cluster carrier protein ApbC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(23-80)

Antitoxin

Uncharacterised protein family HicB

(55-105)


Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9639.14 Da        Isoelectric Point: 11.2766

>T272315 WP_004089517.1 NZ_CP117823:1222784-1223038 [Xylella fastidiosa]
MKRKHAKTLSAIYTRPVSANIQWRDIEALFVELGAKVEEREGSRMLVRLFGERRIFHRPHPSPNTDKGAVESIRAWLKSN
GVTP

Download         Length: 255 bp

Antitoxin


Download         Length: 112 a.a.        Molecular weight: 12324.07 Da        Isoelectric Point: 5.6556

>AT272315 WP_004085025.1 NZ_CP117823:1223035-1223370 [Xylella fastidiosa]
MKNIMTIESFKAIITYDPEIDMFRGEFVGINGGADFYAKDLKGLRREGAISLKVFLEACKEDSVEPRKCYSGKFNARISP
ELHALASEAAAAQGISLNQFVEQAIQHEVHT

Download         Length: 336 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q87BV5

Antitoxin

Source ID Structure
AlphaFold DB A0A060HAK5

References