Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsR-graA/MqsR-HigA |
| Location | 457503..458168 | Replicon | chromosome |
| Accession | NZ_CP117823 | ||
| Organism | Xylella fastidiosa strain ICMP 8742 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | Q87EE2 |
| Locus tag | PUO95_RS01895 | Protein ID | WP_004090696.1 |
| Coordinates | 457866..458168 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | graA | Uniprot ID | - |
| Locus tag | PUO95_RS01890 | Protein ID | WP_004085172.1 |
| Coordinates | 457503..457778 (+) | Length | 92 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUO95_RS01860 (PUO95_01860) | 453634..454335 | - | 702 | WP_228446162.1 | contractile injection system protein, VgrG/Pvc8 family | - |
| PUO95_RS01865 (PUO95_01865) | 454253..455224 | - | 972 | WP_011097609.1 | hypothetical protein | - |
| PUO95_RS01870 (PUO95_01870) | 455232..455789 | - | 558 | WP_011097610.1 | phage tail protein I | - |
| PUO95_RS01875 (PUO95_01875) | 455782..456675 | - | 894 | WP_011097611.1 | baseplate J/gp47 family protein | - |
| PUO95_RS01880 (PUO95_01880) | 456675..457037 | - | 363 | WP_014607615.1 | GPW/gp25 family protein | - |
| PUO95_RS01885 (PUO95_01885) | 457211..457492 | + | 282 | WP_004090695.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PUO95_RS01890 (PUO95_01890) | 457503..457778 | + | 276 | WP_004085172.1 | HigA family addiction module antitoxin | Antitoxin |
| PUO95_RS01895 (PUO95_01895) | 457866..458168 | + | 303 | WP_004090696.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
| PUO95_RS01900 (PUO95_01900) | 458171..458572 | + | 402 | WP_004090697.1 | type II toxin-antitoxin system MqsA family antitoxin | - |
| PUO95_RS01905 (PUO95_01905) | 458641..459228 | - | 588 | WP_011097612.1 | phage baseplate assembly protein V | - |
| PUO95_RS01910 (PUO95_01910) | 459225..459767 | - | 543 | WP_011097613.1 | hypothetical protein | - |
| PUO95_RS01915 (PUO95_01915) | 459743..460264 | - | 522 | WP_057683415.1 | hypothetical protein | - |
| PUO95_RS01920 (PUO95_01920) | 460261..460584 | - | 324 | WP_011097935.1 | hypothetical protein | - |
| PUO95_RS01925 (PUO95_01925) | 460584..460844 | - | 261 | WP_038232801.1 | hypothetical protein | - |
| PUO95_RS01930 (PUO95_01930) | 460862..462736 | - | 1875 | WP_038232803.1 | phage major capsid protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 445809..469722 | 23913 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 10948.71 Da Isoelectric Point: 8.0251
>T272313 WP_004090696.1 NZ_CP117823:457866-458168 [Xylella fastidiosa]
MEKGTSHYKLPVVKALVKAGKVRATATAYQGARELGIKDLTGMCTVVLALTSADFYKSMTTYADHTVFQDVYHAKTASGD
EVYLKLTVIDDVLIVSFKEL
MEKGTSHYKLPVVKALVKAGKVRATATAYQGARELGIKDLTGMCTVVLALTSADFYKSMTTYADHTVFQDVYHAKTASGD
EVYLKLTVIDDVLIVSFKEL
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|