Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mqsR-graA/MqsR-HigA
Location 457503..458168 Replicon chromosome
Accession NZ_CP117823
Organism Xylella fastidiosa strain ICMP 8742

Toxin (Protein)


Gene name mqsR Uniprot ID Q87EE2
Locus tag PUO95_RS01895 Protein ID WP_004090696.1
Coordinates 457866..458168 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name graA Uniprot ID -
Locus tag PUO95_RS01890 Protein ID WP_004085172.1
Coordinates 457503..457778 (+) Length 92 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUO95_RS01860 (PUO95_01860) 453634..454335 - 702 WP_228446162.1 contractile injection system protein, VgrG/Pvc8 family -
PUO95_RS01865 (PUO95_01865) 454253..455224 - 972 WP_011097609.1 hypothetical protein -
PUO95_RS01870 (PUO95_01870) 455232..455789 - 558 WP_011097610.1 phage tail protein I -
PUO95_RS01875 (PUO95_01875) 455782..456675 - 894 WP_011097611.1 baseplate J/gp47 family protein -
PUO95_RS01880 (PUO95_01880) 456675..457037 - 363 WP_014607615.1 GPW/gp25 family protein -
PUO95_RS01885 (PUO95_01885) 457211..457492 + 282 WP_004090695.1 type II toxin-antitoxin system RelE/ParE family toxin -
PUO95_RS01890 (PUO95_01890) 457503..457778 + 276 WP_004085172.1 HigA family addiction module antitoxin Antitoxin
PUO95_RS01895 (PUO95_01895) 457866..458168 + 303 WP_004090696.1 type II toxin-antitoxin system MqsR family toxin Toxin
PUO95_RS01900 (PUO95_01900) 458171..458572 + 402 WP_004090697.1 type II toxin-antitoxin system MqsA family antitoxin -
PUO95_RS01905 (PUO95_01905) 458641..459228 - 588 WP_011097612.1 phage baseplate assembly protein V -
PUO95_RS01910 (PUO95_01910) 459225..459767 - 543 WP_011097613.1 hypothetical protein -
PUO95_RS01915 (PUO95_01915) 459743..460264 - 522 WP_057683415.1 hypothetical protein -
PUO95_RS01920 (PUO95_01920) 460261..460584 - 324 WP_011097935.1 hypothetical protein -
PUO95_RS01925 (PUO95_01925) 460584..460844 - 261 WP_038232801.1 hypothetical protein -
PUO95_RS01930 (PUO95_01930) 460862..462736 - 1875 WP_038232803.1 phage major capsid protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 445809..469722 23913


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin MqsR

(2-99)

Antitoxin

Cro/C1-type helix-turn-helix domain

(15-64)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 10948.71 Da        Isoelectric Point: 8.0251

>T272313 WP_004090696.1 NZ_CP117823:457866-458168 [Xylella fastidiosa]
MEKGTSHYKLPVVKALVKAGKVRATATAYQGARELGIKDLTGMCTVVLALTSADFYKSMTTYADHTVFQDVYHAKTASGD
EVYLKLTVIDDVLIVSFKEL

Download         Length: 303 bp

Antitoxin


Download         Length: 92 a.a.        Molecular weight: 10072.68 Da        Isoelectric Point: 10.2184

>AT272313 WP_004085172.1 NZ_CP117823:457503-457778 [Xylella fastidiosa]
MKRMHNPAHPGEVLREYLGELTVTNAAAKLGVSRVALSRILNGTNGISADMALRLEDALGTSAEMWAAMQFKYDLWVASQ
QPRPKITRLHV

Download         Length: 276 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q87EE2

Antitoxin

Source ID Structure

References