Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
Location | 2381644..2382255 | Replicon | chromosome |
Accession | NZ_CP117821 | ||
Organism | Xylella fastidiosa strain ICMP 8731 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q879T9 |
Locus tag | PT013_RS10575 | Protein ID | WP_011098375.1 |
Coordinates | 2381956..2382255 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q879U0 |
Locus tag | PT013_RS10570 | Protein ID | WP_004085003.1 |
Coordinates | 2381644..2381952 (-) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT013_RS10540 (PT013_10540) | 2378214..2378975 | - | 762 | WP_004090267.1 | Bax inhibitor-1/YccA family protein | - |
PT013_RS10565 (PT013_10565) | 2380167..2381570 | + | 1404 | WP_274205386.1 | hypothetical protein | - |
PT013_RS10570 (PT013_10570) | 2381644..2381952 | - | 309 | WP_004085003.1 | putative addiction module antidote protein | Antitoxin |
PT013_RS10575 (PT013_10575) | 2381956..2382255 | - | 300 | WP_011098375.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PT013_RS10580 (PT013_10580) | 2382310..2382888 | + | 579 | WP_014607536.1 | hypothetical protein | - |
PT013_RS10585 (PT013_10585) | 2382900..2383043 | + | 144 | WP_155115087.1 | hypothetical protein | - |
PT013_RS10590 (PT013_10590) | 2383196..2383576 | - | 381 | WP_004089371.1 | DUF596 domain-containing protein | - |
PT013_RS10595 (PT013_10595) | 2383581..2384711 | - | 1131 | WP_012382788.1 | DUF769 domain-containing protein | - |
PT013_RS10600 (PT013_10600) | 2385019..2385399 | - | 381 | WP_004087391.1 | DUF596 domain-containing protein | - |
PT013_RS10605 (PT013_10605) | 2385411..2386772 | - | 1362 | WP_272819646.1 | hemagglutinin | - |
PT013_RS10610 (PT013_10610) | 2386852..2386995 | + | 144 | WP_155115088.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2332419..2382705 | 50286 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11378.17 Da Isoelectric Point: 10.3861
>T272311 WP_011098375.1 NZ_CP117821:c2382255-2381956 [Xylella fastidiosa]
MTYTLKRLEGFSDWLKGLKDGLARQRLIKRLRKVQLGNFGDVQPVGEGVFEMREHFGPGWRMYYVQRGSFLIVMLGGGDK
STQQSDIRRAIELAKSLED
MTYTLKRLEGFSDWLKGLKDGLARQRLIKRLRKVQLGNFGDVQPVGEGVFEMREHFGPGWRMYYVQRGSFLIVMLGGGDK
STQQSDIRRAIELAKSLED
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q879T9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060HCD4 |