Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 1468574..1469160 Replicon chromosome
Accession NZ_CP117821
Organism Xylella fastidiosa strain ICMP 8731

Toxin (Protein)


Gene name hicA Uniprot ID Q87BV5
Locus tag PT013_RS06660 Protein ID WP_004089517.1
Coordinates 1468906..1469160 (-) Length 85 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID B2I6C9
Locus tag PT013_RS06655 Protein ID WP_004085025.1
Coordinates 1468574..1468909 (-) Length 112 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PT013_RS06625 (PT013_06625) 1464173..1465084 - 912 WP_004089529.1 iron-sulfur cluster carrier protein ApbC -
PT013_RS06630 (PT013_06630) 1465519..1466292 + 774 WP_004089528.1 3-deoxy-manno-octulosonate cytidylyltransferase -
PT013_RS06635 (PT013_06635) 1466289..1466753 + 465 WP_011098056.1 low molecular weight protein-tyrosine-phosphatase -
PT013_RS06640 (PT013_06640) 1466740..1467453 - 714 WP_011098057.1 site-specific DNA-methyltransferase -
PT013_RS06645 (PT013_06645) 1467804..1468085 + 282 WP_011098058.1 type II toxin-antitoxin system RelE/ParE family toxin -
PT013_RS06650 (PT013_06650) 1468095..1468394 + 300 WP_004089519.1 HigA family addiction module antitoxin -
PT013_RS06655 (PT013_06655) 1468574..1468909 - 336 WP_004085025.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
PT013_RS06660 (PT013_06660) 1468906..1469160 - 255 WP_004089517.1 type II toxin-antitoxin system HicA family toxin Toxin
PT013_RS06665 (PT013_06665) 1469213..1469911 - 699 WP_011098059.1 hypothetical protein -
PT013_RS06670 (PT013_06670) 1470040..1470501 - 462 WP_011098060.1 hypothetical protein -
PT013_RS06675 (PT013_06675) 1470498..1471187 - 690 WP_011098061.1 hypothetical protein -
PT013_RS06680 (PT013_06680) 1471168..1472274 - 1107 WP_012382665.1 YdaU family protein -
PT013_RS06685 (PT013_06685) 1472271..1472516 - 246 WP_225621698.1 hypothetical protein -
PT013_RS06690 (PT013_06690) 1472672..1473046 + 375 WP_004091110.1 conjugal transfer protein -
PT013_RS06695 (PT013_06695) 1473052..1473657 + 606 WP_004091108.1 conjugal transfer protein TrbN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(23-80)

Antitoxin

Uncharacterised protein family HicB

(55-105)


Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9639.14 Da        Isoelectric Point: 11.2766

>T272310 WP_004089517.1 NZ_CP117821:c1469160-1468906 [Xylella fastidiosa]
MKRKHAKTLSAIYTRPVSANIQWRDIEALFVELGAKVEEREGSRMLVRLFGERRIFHRPHPSPNTDKGAVESIRAWLKSN
GVTP

Download         Length: 255 bp

Antitoxin


Download         Length: 112 a.a.        Molecular weight: 12324.07 Da        Isoelectric Point: 5.6556

>AT272310 WP_004085025.1 NZ_CP117821:c1468909-1468574 [Xylella fastidiosa]
MKNIMTIESFKAIITYDPEIDMFRGEFVGINGGADFYAKDLKGLRREGAISLKVFLEACKEDSVEPRKCYSGKFNARISP
ELHALASEAAAAQGISLNQFVEQAIQHEVHT

Download         Length: 336 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q87BV5

Antitoxin

Source ID Structure
AlphaFold DB A0A060HAK5

References