Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pasABC/RelE-HTH
Location 1279556..1280033 Replicon chromosome
Accession NZ_CP117821
Organism Xylella fastidiosa strain ICMP 8731

Toxin (Protein)


Gene name pasB Uniprot ID Q87CA4
Locus tag PT013_RS05815 Protein ID WP_011097988.1
Coordinates 1279767..1280033 (+) Length 89 a.a.

Antitoxin (Protein)


Gene name pasA Uniprot ID A0A7G7TPD2
Locus tag PT013_RS05810 Protein ID WP_004091377.1
Coordinates 1279556..1279783 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PT013_RS05770 (PT013_05770) 1274683..1275828 - 1146 WP_011097984.1 baseplate J/gp47 family protein -
PT013_RS05775 (PT013_05775) 1275927..1276223 + 297 WP_004089252.1 type II toxin-antitoxin system RelE/ParE family toxin -
PT013_RS05780 (PT013_05780) 1276227..1276532 + 306 WP_004089254.1 putative addiction module antidote protein -
PT013_RS05785 (PT013_05785) 1276543..1276896 - 354 WP_011097986.1 hypothetical protein -
PT013_RS05790 (PT013_05790) 1276893..1277534 - 642 WP_004090764.1 Gp138 family membrane-puncturing spike protein -
PT013_RS05795 (PT013_05795) 1277531..1278361 - 831 WP_004090766.1 hypothetical protein -
PT013_RS05800 (PT013_05800) 1278358..1278675 - 318 WP_011097873.1 hypothetical protein -
PT013_RS05805 (PT013_05805) 1278675..1279445 - 771 WP_004090769.1 hypothetical protein -
PT013_RS05810 (PT013_05810) 1279556..1279783 + 228 WP_004091377.1 DUF6290 family protein Antitoxin
PT013_RS05815 (PT013_05815) 1279767..1280033 + 267 WP_011097988.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PT013_RS05820 (PT013_05820) 1280044..1281837 - 1794 WP_228446142.1 phage tail tape measure protein -
PT013_RS05825 (PT013_05825) 1282081..1282503 - 423 WP_004085005.1 putative phage tail assembly chaperone -
PT013_RS05830 (PT013_05830) 1282500..1282937 - 438 WP_011097990.1 DUF3277 family protein -
PT013_RS05835 (PT013_05835) 1282947..1283180 - 234 WP_011097991.1 DUF3383 family protein -
PT013_RS05840 (PT013_05840) 1283197..1284075 - 879 WP_012382645.1 RNA-guided endonuclease TnpB family protein -
PT013_RS05845 (PT013_05845) 1284241..1284402 - 162 WP_014607806.1 helix-turn-helix domain-containing protein -
PT013_RS05850 (PT013_05850) 1284396..1285001 - 606 Protein_1139 IS607 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1272878..1315792 42914
- flank IS/Tn - - 1284396..1284617 221


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10163.79 Da        Isoelectric Point: 10.6086

>T272309 WP_011097988.1 NZ_CP117821:1279767-1280033 [Xylella fastidiosa]
MAWTIDYTDTAKQQLRKLDKHMARRIVDFMDERIAGLENPRSSGKALTGPLGGFWRYRVGDFRVVCAIQDSVLRVLVVRV
GHRGEIYR

Download         Length: 267 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8615.63 Da        Isoelectric Point: 5.0958

>AT272309 WP_004091377.1 NZ_CP117821:1279556-1279783 [Xylella fastidiosa]
MATSIRLSPEMEQRLNSLASHTGRTKAYYLREIIEHGIEEMEDYYLAADVLERVRHGQEQVHSAADVRKTLGLDD

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A060HDH1

Antitoxin

Source ID Structure
AlphaFold DB A0A7G7TPD2

References