Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/COG3657-DUF971 |
Location | 1275927..1276532 | Replicon | chromosome |
Accession | NZ_CP117821 | ||
Organism | Xylella fastidiosa strain ICMP 8731 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | B2I5N3 |
Locus tag | PT013_RS05775 | Protein ID | WP_004089252.1 |
Coordinates | 1275927..1276223 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PT013_RS05780 | Protein ID | WP_004089254.1 |
Coordinates | 1276227..1276532 (+) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT013_RS05750 (PT013_05750) | 1271092..1272069 | + | 978 | WP_004087353.1 | hypothetical protein | - |
PT013_RS05755 (PT013_05755) | 1272328..1272774 | + | 447 | WP_004087355.1 | hypothetical protein | - |
PT013_RS05760 (PT013_05760) | 1272878..1274122 | - | 1245 | WP_011097983.1 | tail fiber protein | - |
PT013_RS05765 (PT013_05765) | 1274126..1274686 | - | 561 | WP_011097869.1 | DUF2612 domain-containing protein | - |
PT013_RS05770 (PT013_05770) | 1274683..1275828 | - | 1146 | WP_011097984.1 | baseplate J/gp47 family protein | - |
PT013_RS05775 (PT013_05775) | 1275927..1276223 | + | 297 | WP_004089252.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PT013_RS05780 (PT013_05780) | 1276227..1276532 | + | 306 | WP_004089254.1 | putative addiction module antidote protein | Antitoxin |
PT013_RS05785 (PT013_05785) | 1276543..1276896 | - | 354 | WP_011097986.1 | hypothetical protein | - |
PT013_RS05790 (PT013_05790) | 1276893..1277534 | - | 642 | WP_004090764.1 | Gp138 family membrane-puncturing spike protein | - |
PT013_RS05795 (PT013_05795) | 1277531..1278361 | - | 831 | WP_004090766.1 | hypothetical protein | - |
PT013_RS05800 (PT013_05800) | 1278358..1278675 | - | 318 | WP_011097873.1 | hypothetical protein | - |
PT013_RS05805 (PT013_05805) | 1278675..1279445 | - | 771 | WP_004090769.1 | hypothetical protein | - |
PT013_RS05810 (PT013_05810) | 1279556..1279783 | + | 228 | WP_004091377.1 | DUF6290 family protein | - |
PT013_RS05815 (PT013_05815) | 1279767..1280033 | + | 267 | WP_011097988.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1272878..1315792 | 42914 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 10790.57 Da Isoelectric Point: 10.0509
>T272308 WP_004089252.1 NZ_CP117821:1275927-1276223 [Xylella fastidiosa]
MVELIKTSTFDAWINSLRDRKAAARIQARLDRLALGNPGDVKPVGAGISEMRIDHGPGYRIYFMKHGAVLILLLCGGDKS
SQVRDIEQAKALAALWKD
MVELIKTSTFDAWINSLRDRKAAARIQARLDRLALGNPGDVKPVGAGISEMRIDHGPGYRIYFMKHGAVLILLLCGGDKS
SQVRDIEQAKALAALWKD
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|