272306

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) FicTA/Fic(toxin)
Location 1103894..1104690 Replicon chromosome
Accession NZ_CP117821
Organism Xylella fastidiosa strain ICMP 8731

Toxin (Protein)


Gene name VbhT Uniprot ID Q87CQ8
Locus tag PT013_RS04830 Protein ID WP_004088112.1
Coordinates 1103894..1104505 (-) Length 204 a.a.

Antitoxin (Protein)


Gene name VbhA Uniprot ID B2I551
Locus tag PT013_RS04835 Protein ID WP_004088114.1
Coordinates 1104502..1104690 (-) Length 63 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PT013_RS04785 (PT013_04785) 1099349..1100236 - 888 WP_012382597.1 YdaU family protein -
PT013_RS04790 (PT013_04790) 1100233..1101021 - 789 WP_011097897.1 Bro-N domain-containing protein -
PT013_RS04795 (PT013_04795) 1101018..1101650 - 633 WP_004088094.1 Bro-N domain-containing protein -
PT013_RS04800 (PT013_04800) 1101647..1101910 - 264 WP_228446177.1 hypothetical protein -
PT013_RS04805 (PT013_04805) 1101928..1102143 - 216 WP_012382598.1 hypothetical protein -
PT013_RS04810 (PT013_04810) 1102173..1102361 - 189 WP_004088102.1 hypothetical protein -
PT013_RS04815 (PT013_04815) 1102389..1102580 - 192 WP_004088104.1 hypothetical protein -
PT013_RS04820 (PT013_04820) 1102839..1103084 - 246 WP_004088108.1 hypothetical protein -
PT013_RS04825 (PT013_04825) 1103169..1103843 + 675 WP_012382600.1 helix-turn-helix transcriptional regulator -
PT013_RS04830 (PT013_04830) 1103894..1104505 - 612 WP_004088112.1 Fic/DOC family protein Toxin
PT013_RS04835 (PT013_04835) 1104502..1104690 - 189 WP_004088114.1 antitoxin VbhA family protein Antitoxin
PT013_RS04840 (PT013_04840) 1105082..1105618 + 537 WP_012382601.1 hypothetical protein -
PT013_RS04845 (PT013_04845) 1105615..1106028 + 414 WP_004088056.1 DUF1566 domain-containing protein -
PT013_RS04850 (PT013_04850) 1106025..1106426 + 402 WP_004088054.1 hypothetical protein -
PT013_RS04855 (PT013_04855) 1106423..1106572 + 150 WP_012382602.1 hypothetical protein -
PT013_RS04860 (PT013_04860) 1106790..1106936 + 147 WP_225621633.1 hypothetical protein -
PT013_RS04865 (PT013_04865) 1106959..1107150 + 192 WP_012382603.1 hypothetical protein -
PT013_RS04870 (PT013_04870) 1107171..1107515 + 345 WP_004088346.1 hypothetical protein -
PT013_RS04875 (PT013_04875) 1107555..1108376 + 822 WP_004088345.1 DUF2303 family protein -
PT013_RS04880 (PT013_04880) 1108392..1109318 + 927 WP_004088344.1 phage recombination protein Bet -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(55-152)

Antitoxin

Antitoxin VbhA

(10-56)


Sequences

Toxin        


Download         Length: 204 a.a.        Molecular weight: 22832.60 Da        Isoelectric Point: 5.1271

>T272306 WP_004088112.1 NZ_CP117821:c1104505-1103894 [Xylella fastidiosa]
MKYAGDRGDPYLDSETGVLRNLLGIRDQGGLDKIESTLSFLRTSELRERPVKGKFDLAHLQEIHNRLFQDVYDWAGQIRQ
VEISKGNTMFAQQIAIQSAAQQIFGQLAKERFLCGLDAEEFSKRAGDYLGEINVLHPFREGNGRTQREFIAQLAQRAGYR
IDWGVVSQADMIKASIDAYNGDSSGLASIIREGISDQLFKDNE

Download         Length: 612 bp

Antitoxin


Download         Length: 63 a.a.        Molecular weight: 6837.77 Da        Isoelectric Point: 4.9859

>AT272306 WP_004088114.1 NZ_CP117821:c1104690-1104502 [Xylella fastidiosa]
MLTDHEKAERRAVVQSALASQRIEGLEPDAQAVVDAECWARGEMTIAAAVDQYKARVRLQIA

Download         Length: 189 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q87CQ8

Antitoxin

Source ID Structure
AlphaFold DB B2I551

References