Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 2524338..2525021 | Replicon | chromosome |
Accession | NZ_CP117820 | ||
Organism | Xylella fastidiosa strain ICMP 8740 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PT012_RS11340 | Protein ID | WP_004086858.1 |
Coordinates | 2524338..2524766 (-) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PT012_RS11345 | Protein ID | WP_004086856.1 |
Coordinates | 2524767..2525021 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT012_RS11310 (PT012_11310) | 2520892..2521653 | - | 762 | WP_004085598.1 | Bax inhibitor-1/YccA family protein | - |
PT012_RS11335 (PT012_11335) | 2522854..2524248 | + | 1395 | WP_272819586.1 | hypothetical protein | - |
PT012_RS11340 (PT012_11340) | 2524338..2524766 | - | 429 | WP_004086858.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PT012_RS11345 (PT012_11345) | 2524767..2525021 | - | 255 | WP_004086856.1 | hypothetical protein | Antitoxin |
PT012_RS11350 (PT012_11350) | 2525146..2525688 | + | 543 | WP_071870032.1 | hypothetical protein | - |
PT012_RS11355 (PT012_11355) | 2526009..2526382 | - | 374 | Protein_2211 | DUF596 domain-containing protein | - |
PT012_RS11360 (PT012_11360) | 2526394..2526699 | - | 306 | WP_228762248.1 | DUF769 domain-containing protein | - |
PT012_RS11365 (PT012_11365) | 2526898..2527290 | - | 393 | WP_038211775.1 | DUF596 domain-containing protein | - |
PT012_RS11370 (PT012_11370) | 2527301..2527558 | - | 258 | WP_021358680.1 | hemagglutinin | - |
PT012_RS11375 (PT012_11375) | 2527832..2528215 | - | 384 | WP_004086848.1 | DUF596 domain-containing protein | - |
PT012_RS11380 (PT012_11380) | 2528220..2529257 | - | 1038 | WP_004086846.1 | DUF769 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15641.79 Da Isoelectric Point: 5.1634
>T272302 WP_004086858.1 NZ_CP117820:c2524766-2524338 [Xylella fastidiosa]
MIVLDTNVVSEAMKPEPDAAVRTWLNEQMSVTLYLSSVTLSELLFGIAVLPTSKRKDMLARTLDGLLDLFNERVLPFDTD
AARHYAELAVKARNNGRGFPTPDGYIAAIAASRGYIVASRDTSAYESSGVQVINPWQYSKQT
MIVLDTNVVSEAMKPEPDAAVRTWLNEQMSVTLYLSSVTLSELLFGIAVLPTSKRKDMLARTLDGLLDLFNERVLPFDTD
AARHYAELAVKARNNGRGFPTPDGYIAAIAASRGYIVASRDTSAYESSGVQVINPWQYSKQT
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|