Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) FicTA/Fic(toxin)
Location 1888691..1889487 Replicon chromosome
Accession NZ_CP117820
Organism Xylella fastidiosa strain ICMP 8740

Toxin (Protein)


Gene name VbhT Uniprot ID -
Locus tag PT012_RS08720 Protein ID WP_004087040.1
Coordinates 1888691..1889302 (-) Length 204 a.a.

Antitoxin (Protein)


Gene name VbhA Uniprot ID A0A060HF63
Locus tag PT012_RS08725 Protein ID WP_004087046.1
Coordinates 1889299..1889487 (-) Length 63 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PT012_RS08675 (PT012_08675) 1884394..1884654 - 261 WP_248638125.1 hypothetical protein -
PT012_RS08680 (PT012_08680) 1884651..1885439 - 789 WP_128723964.1 Bro-N domain-containing protein -
PT012_RS08685 (PT012_08685) 1885439..1886035 - 597 WP_272819598.1 Bro-N domain-containing protein -
PT012_RS08690 (PT012_08690) 1886293..1886658 - 366 WP_038229950.1 hypothetical protein -
PT012_RS08695 (PT012_08695) 1886655..1886870 - 216 WP_230577619.1 hypothetical protein -
PT012_RS08700 (PT012_08700) 1886900..1887088 - 189 WP_020851634.1 hypothetical protein -
PT012_RS08705 (PT012_08705) 1887149..1887646 - 498 WP_169719191.1 hypothetical protein -
PT012_RS08710 (PT012_08710) 1887636..1887881 - 246 WP_027700625.1 hypothetical protein -
PT012_RS08715 (PT012_08715) 1887966..1888640 + 675 WP_027700624.1 helix-turn-helix transcriptional regulator -
PT012_RS08720 (PT012_08720) 1888691..1889302 - 612 WP_004087040.1 Fic/DOC family protein Toxin
PT012_RS08725 (PT012_08725) 1889299..1889487 - 189 WP_004087046.1 antitoxin VbhA family protein Antitoxin
PT012_RS08730 (PT012_08730) 1889881..1890336 + 456 WP_027700622.1 hypothetical protein -
PT012_RS08735 (PT012_08735) 1890333..1890803 + 471 WP_027700621.1 DUF1566 domain-containing protein -
PT012_RS08740 (PT012_08740) 1890800..1891207 + 408 WP_027700620.1 hypothetical protein -
PT012_RS08745 (PT012_08745) 1891204..1891395 + 192 WP_004086365.1 hypothetical protein -
PT012_RS08750 (PT012_08750) 1891571..1891966 + 396 WP_241557581.1 hypothetical protein -
PT012_RS08755 (PT012_08755) 1891935..1892276 + 342 WP_274169890.1 hypothetical protein -
PT012_RS08760 (PT012_08760) 1892297..1892641 + 345 WP_027700617.1 hypothetical protein -
PT012_RS08765 (PT012_08765) 1892682..1893503 + 822 WP_027700618.1 DUF2303 family protein -
PT012_RS08770 (PT012_08770) 1893519..1894439 + 921 WP_027700619.1 phage recombination protein Bet -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1850640..1907733 57093


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(55-152)

Antitoxin

Antitoxin VbhA

(10-56)


Sequences

Toxin        


Download         Length: 204 a.a.        Molecular weight: 22961.76 Da        Isoelectric Point: 5.1271

>T272301 WP_004087040.1 NZ_CP117820:c1889302-1888691 [Xylella fastidiosa]
MKYAGDRGDPYLDSETGVLRNLLGIRDQGWLDKIESTLSFLRTSELRERPVKGKFDLAHLQEIHNRLFQDVYDWAGQIRQ
VEISKGNTMFAQQIAIQSAAQQIFGQLAKERFLCGLDAEEFSKRAGDYLGEINVLHPFREGNGRTQREFIAQLAQRAGYR
IDWGVVSQADMIKASIDAYNGDSSGLASIIREGISDQLFKDNE

Download         Length: 612 bp

Antitoxin


Download         Length: 63 a.a.        Molecular weight: 6855.80 Da        Isoelectric Point: 4.9859

>AT272301 WP_004087046.1 NZ_CP117820:c1889487-1889299 [Xylella fastidiosa]
MLTDHEKAERRAVVQSALASQRIEGLEPDAQAVVDAECWARGEMTIAAAVDQYKARVRLQMA

Download         Length: 189 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A060HF63

References