Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | FicTA/Fic(toxin) |
Location | 1888691..1889487 | Replicon | chromosome |
Accession | NZ_CP117820 | ||
Organism | Xylella fastidiosa strain ICMP 8740 |
Toxin (Protein)
Gene name | VbhT | Uniprot ID | - |
Locus tag | PT012_RS08720 | Protein ID | WP_004087040.1 |
Coordinates | 1888691..1889302 (-) | Length | 204 a.a. |
Antitoxin (Protein)
Gene name | VbhA | Uniprot ID | A0A060HF63 |
Locus tag | PT012_RS08725 | Protein ID | WP_004087046.1 |
Coordinates | 1889299..1889487 (-) | Length | 63 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT012_RS08675 (PT012_08675) | 1884394..1884654 | - | 261 | WP_248638125.1 | hypothetical protein | - |
PT012_RS08680 (PT012_08680) | 1884651..1885439 | - | 789 | WP_128723964.1 | Bro-N domain-containing protein | - |
PT012_RS08685 (PT012_08685) | 1885439..1886035 | - | 597 | WP_272819598.1 | Bro-N domain-containing protein | - |
PT012_RS08690 (PT012_08690) | 1886293..1886658 | - | 366 | WP_038229950.1 | hypothetical protein | - |
PT012_RS08695 (PT012_08695) | 1886655..1886870 | - | 216 | WP_230577619.1 | hypothetical protein | - |
PT012_RS08700 (PT012_08700) | 1886900..1887088 | - | 189 | WP_020851634.1 | hypothetical protein | - |
PT012_RS08705 (PT012_08705) | 1887149..1887646 | - | 498 | WP_169719191.1 | hypothetical protein | - |
PT012_RS08710 (PT012_08710) | 1887636..1887881 | - | 246 | WP_027700625.1 | hypothetical protein | - |
PT012_RS08715 (PT012_08715) | 1887966..1888640 | + | 675 | WP_027700624.1 | helix-turn-helix transcriptional regulator | - |
PT012_RS08720 (PT012_08720) | 1888691..1889302 | - | 612 | WP_004087040.1 | Fic/DOC family protein | Toxin |
PT012_RS08725 (PT012_08725) | 1889299..1889487 | - | 189 | WP_004087046.1 | antitoxin VbhA family protein | Antitoxin |
PT012_RS08730 (PT012_08730) | 1889881..1890336 | + | 456 | WP_027700622.1 | hypothetical protein | - |
PT012_RS08735 (PT012_08735) | 1890333..1890803 | + | 471 | WP_027700621.1 | DUF1566 domain-containing protein | - |
PT012_RS08740 (PT012_08740) | 1890800..1891207 | + | 408 | WP_027700620.1 | hypothetical protein | - |
PT012_RS08745 (PT012_08745) | 1891204..1891395 | + | 192 | WP_004086365.1 | hypothetical protein | - |
PT012_RS08750 (PT012_08750) | 1891571..1891966 | + | 396 | WP_241557581.1 | hypothetical protein | - |
PT012_RS08755 (PT012_08755) | 1891935..1892276 | + | 342 | WP_274169890.1 | hypothetical protein | - |
PT012_RS08760 (PT012_08760) | 1892297..1892641 | + | 345 | WP_027700617.1 | hypothetical protein | - |
PT012_RS08765 (PT012_08765) | 1892682..1893503 | + | 822 | WP_027700618.1 | DUF2303 family protein | - |
PT012_RS08770 (PT012_08770) | 1893519..1894439 | + | 921 | WP_027700619.1 | phage recombination protein Bet | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1850640..1907733 | 57093 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 204 a.a. Molecular weight: 22961.76 Da Isoelectric Point: 5.1271
>T272301 WP_004087040.1 NZ_CP117820:c1889302-1888691 [Xylella fastidiosa]
MKYAGDRGDPYLDSETGVLRNLLGIRDQGWLDKIESTLSFLRTSELRERPVKGKFDLAHLQEIHNRLFQDVYDWAGQIRQ
VEISKGNTMFAQQIAIQSAAQQIFGQLAKERFLCGLDAEEFSKRAGDYLGEINVLHPFREGNGRTQREFIAQLAQRAGYR
IDWGVVSQADMIKASIDAYNGDSSGLASIIREGISDQLFKDNE
MKYAGDRGDPYLDSETGVLRNLLGIRDQGWLDKIESTLSFLRTSELRERPVKGKFDLAHLQEIHNRLFQDVYDWAGQIRQ
VEISKGNTMFAQQIAIQSAAQQIFGQLAKERFLCGLDAEEFSKRAGDYLGEINVLHPFREGNGRTQREFIAQLAQRAGYR
IDWGVVSQADMIKASIDAYNGDSSGLASIIREGISDQLFKDNE
Download Length: 612 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|