Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 1861379..1861971 | Replicon | chromosome |
| Accession | NZ_CP117820 | ||
| Organism | Xylella fastidiosa strain ICMP 8740 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | A0A060HCK8 |
| Locus tag | PT012_RS08515 | Protein ID | WP_004085590.1 |
| Coordinates | 1861379..1861675 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | PT012_RS08520 | Protein ID | WP_004085592.1 |
| Coordinates | 1861678..1861971 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT012_RS08495 (PT012_08495) | 1856898..1857902 | - | 1005 | WP_027700600.1 | peptidase | - |
| PT012_RS08500 (PT012_08500) | 1858407..1859570 | - | 1164 | WP_274169883.1 | phage tail protein | - |
| PT012_RS08505 (PT012_08505) | 1859574..1860134 | - | 561 | WP_027700634.1 | DUF2612 domain-containing protein | - |
| PT012_RS08510 (PT012_08510) | 1860131..1861276 | - | 1146 | WP_027700633.1 | baseplate J/gp47 family protein | - |
| PT012_RS08515 (PT012_08515) | 1861379..1861675 | + | 297 | WP_004085590.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PT012_RS08520 (PT012_08520) | 1861678..1861971 | + | 294 | WP_004085592.1 | putative addiction module antidote protein | Antitoxin |
| PT012_RS08525 (PT012_08525) | 1862027..1862380 | - | 354 | WP_027700632.1 | hypothetical protein | - |
| PT012_RS08530 (PT012_08530) | 1862377..1863018 | - | 642 | WP_012382583.1 | Gp138 family membrane-puncturing spike protein | - |
| PT012_RS08535 (PT012_08535) | 1863015..1863845 | - | 831 | WP_027700631.1 | hypothetical protein | - |
| PT012_RS08540 (PT012_08540) | 1863842..1864159 | - | 318 | WP_012382585.1 | hypothetical protein | - |
| PT012_RS08545 (PT012_08545) | 1864159..1864929 | - | 771 | WP_272819576.1 | hypothetical protein | - |
| PT012_RS08550 (PT012_08550) | 1865282..1865536 | - | 255 | WP_027700683.1 | Blp family class II bacteriocin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1850640..1907733 | 57093 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11169.70 Da Isoelectric Point: 10.0610
>T272300 WP_004085590.1 NZ_CP117820:1861379-1861675 [Xylella fastidiosa]
MIELKQTDTFRKWREKLKDARARSAIASRLDRLAFGHVGDAEPVGKGVSELRINYGPGYRVYFQRRGDTIYLLLCGGDKG
SQARDIKTALHLSEQWSE
MIELKQTDTFRKWREKLKDARARSAIASRLDRLAFGHVGDAEPVGKGVSELRINYGPGYRVYFQRRGDTIYLLLCGGDKG
SQARDIKTALHLSEQWSE
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|