Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RHH(antitoxin)
Location 1649615..1650137 Replicon chromosome
Accession NZ_CP117820
Organism Xylella fastidiosa strain ICMP 8740

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag PT012_RS07470 Protein ID WP_004085905.1
Coordinates 1649850..1650137 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A060HDF9
Locus tag PT012_RS07465 Protein ID WP_004085758.1
Coordinates 1649615..1649857 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PT012_RS07435 (PT012_07435) 1645025..1645207 + 183 WP_027700467.1 hypothetical protein -
PT012_RS07440 (PT012_07440) 1645491..1646417 - 927 WP_027700468.1 Grx4 family monothiol glutaredoxin -
PT012_RS07445 (PT012_07445) 1646516..1647259 + 744 WP_225621865.1 polysaccharide deacetylase family protein -
PT012_RS07450 (PT012_07450) 1647903..1648094 - 192 WP_027700471.1 hypothetical protein -
PT012_RS07455 (PT012_07455) 1648512..1648931 - 420 WP_004085763.1 putative toxin-antitoxin system toxin component, PIN family -
PT012_RS07460 (PT012_07460) 1648931..1649170 - 240 WP_004085761.1 ribbon-helix-helix domain-containing protein -
PT012_RS07465 (PT012_07465) 1649615..1649857 + 243 WP_004085758.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
PT012_RS07470 (PT012_07470) 1649850..1650137 + 288 WP_004085905.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PT012_RS07475 (PT012_07475) 1650225..1650791 + 567 WP_004085755.1 recombinase family protein -
PT012_RS07480 (PT012_07480) 1650808..1652040 - 1233 WP_140160997.1 RNA-guided endonuclease TnpB family protein -
PT012_RS07485 (PT012_07485) 1652034..1652660 - 627 WP_140160998.1 IS607 family transposase -
PT012_RS07490 (PT012_07490) 1652890..1654164 - 1275 WP_012337985.1 pyridoxal phosphate-dependent aminotransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1648109..1669414 21305
- flank IS/Tn - - 1650225..1650791 566


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-90)

Antitoxin

Antitoxin ParD

(1-78)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11159.64 Da        Isoelectric Point: 5.9570

>T272299 WP_004085905.1 NZ_CP117820:1649850-1650137 [Xylella fastidiosa]
MAKSYRLTPLAEADLEEIWFYTFRHWSIEQADSYHRSLVAVFEGLAAGTKQGCPSVLPDFNKYLCGSHVVYFMDYADHLD
IIRILHQRQDTERYL

Download         Length: 288 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8774.77 Da        Isoelectric Point: 6.9881

>AT272299 WP_004085758.1 NZ_CP117820:1649615-1649857 [Xylella fastidiosa]
MSRNTSVALGPHFTSFIDAQVQGGRYGTASDVVRAGLRLLEEHETKVKALQDALNVGHQSGEPRPFDSEVFLSRMHTQHG

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A060HDF9

References