Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pasABC/RelE-HTH
Location 1382219..1382696 Replicon chromosome
Accession NZ_CP117820
Organism Xylella fastidiosa strain ICMP 8740

Toxin (Protein)


Gene name pasB Uniprot ID -
Locus tag PT012_RS06250 Protein ID WP_004087087.1
Coordinates 1382430..1382696 (+) Length 89 a.a.

Antitoxin (Protein)


Gene name pasA Uniprot ID A0A7G7TPD2
Locus tag PT012_RS06245 Protein ID WP_004091377.1
Coordinates 1382219..1382446 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PT012_RS06205 (PT012_06205) 1377310..1378455 - 1146 WP_027700633.1 baseplate J/gp47 family protein -
PT012_RS06210 (PT012_06210) 1378558..1378854 + 297 WP_004085590.1 type II toxin-antitoxin system RelE/ParE family toxin -
PT012_RS06215 (PT012_06215) 1378857..1379150 + 294 WP_004085592.1 putative addiction module antidote protein -
PT012_RS06220 (PT012_06220) 1379206..1379559 - 354 WP_027700632.1 hypothetical protein -
PT012_RS06225 (PT012_06225) 1379556..1380197 - 642 WP_012382583.1 Gp138 family membrane-puncturing spike protein -
PT012_RS06230 (PT012_06230) 1380194..1381024 - 831 WP_027700631.1 hypothetical protein -
PT012_RS06235 (PT012_06235) 1381021..1381338 - 318 WP_012382585.1 hypothetical protein -
PT012_RS06240 (PT012_06240) 1381338..1382108 - 771 WP_274169884.1 hypothetical protein -
PT012_RS06245 (PT012_06245) 1382219..1382446 + 228 WP_004091377.1 DUF6290 family protein Antitoxin
PT012_RS06250 (PT012_06250) 1382430..1382696 + 267 WP_004087087.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PT012_RS06255 (PT012_06255) 1382707..1384596 - 1890 WP_274169885.1 hypothetical protein -
PT012_RS06260 (PT012_06260) 1384744..1384986 - 243 WP_234499994.1 putative phage tail assembly chaperone -
PT012_RS06265 (PT012_06265) 1385004..1385342 - 339 WP_274169886.1 hypothetical protein -
PT012_RS06270 (PT012_06270) 1385352..1385834 - 483 WP_004090290.1 hypothetical protein -
PT012_RS06275 (PT012_06275) 1385844..1387142 - 1299 WP_272819578.1 DUF2213 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1351620..1395547 43927


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10207.80 Da        Isoelectric Point: 10.3398

>T272298 WP_004087087.1 NZ_CP117820:1382430-1382696 [Xylella fastidiosa]
MAWTIDYTDTAKQQLRKLDKHMARRIVDFMDERIAGLENPRSSGKALTGPLGGFWRYRVGDFRVVCDIQDSVLRVLVVRV
GHRGEIYR

Download         Length: 267 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8615.63 Da        Isoelectric Point: 5.0958

>AT272298 WP_004091377.1 NZ_CP117820:1382219-1382446 [Xylella fastidiosa]
MATSIRLSPEMEQRLNSLASHTGRTKAYYLREIIEHGIEEMEDYYLAADVLERVRHGQEQVHSAADVRKTLGLDD

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A7G7TPD2

References