Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 1378558..1379150 | Replicon | chromosome |
Accession | NZ_CP117820 | ||
Organism | Xylella fastidiosa strain ICMP 8740 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A060HCK8 |
Locus tag | PT012_RS06210 | Protein ID | WP_004085590.1 |
Coordinates | 1378558..1378854 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | PT012_RS06215 | Protein ID | WP_004085592.1 |
Coordinates | 1378857..1379150 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT012_RS06190 (PT012_06190) | 1374077..1375081 | - | 1005 | WP_027700600.1 | peptidase | - |
PT012_RS06195 (PT012_06195) | 1375586..1376749 | - | 1164 | WP_274169883.1 | phage tail protein | - |
PT012_RS06200 (PT012_06200) | 1376753..1377313 | - | 561 | WP_027700634.1 | DUF2612 domain-containing protein | - |
PT012_RS06205 (PT012_06205) | 1377310..1378455 | - | 1146 | WP_027700633.1 | baseplate J/gp47 family protein | - |
PT012_RS06210 (PT012_06210) | 1378558..1378854 | + | 297 | WP_004085590.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PT012_RS06215 (PT012_06215) | 1378857..1379150 | + | 294 | WP_004085592.1 | putative addiction module antidote protein | Antitoxin |
PT012_RS06220 (PT012_06220) | 1379206..1379559 | - | 354 | WP_027700632.1 | hypothetical protein | - |
PT012_RS06225 (PT012_06225) | 1379556..1380197 | - | 642 | WP_012382583.1 | Gp138 family membrane-puncturing spike protein | - |
PT012_RS06230 (PT012_06230) | 1380194..1381024 | - | 831 | WP_027700631.1 | hypothetical protein | - |
PT012_RS06235 (PT012_06235) | 1381021..1381338 | - | 318 | WP_012382585.1 | hypothetical protein | - |
PT012_RS06240 (PT012_06240) | 1381338..1382108 | - | 771 | WP_274169884.1 | hypothetical protein | - |
PT012_RS06245 (PT012_06245) | 1382219..1382446 | + | 228 | WP_004091377.1 | DUF6290 family protein | - |
PT012_RS06250 (PT012_06250) | 1382430..1382696 | + | 267 | WP_004087087.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1351620..1395547 | 43927 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11169.70 Da Isoelectric Point: 10.0610
>T272297 WP_004085590.1 NZ_CP117820:1378558-1378854 [Xylella fastidiosa]
MIELKQTDTFRKWREKLKDARARSAIASRLDRLAFGHVGDAEPVGKGVSELRINYGPGYRVYFQRRGDTIYLLLCGGDKG
SQARDIKTALHLSEQWSE
MIELKQTDTFRKWREKLKDARARSAIASRLDRLAFGHVGDAEPVGKGVSELRINYGPGYRVYFQRRGDTIYLLLCGGDKG
SQARDIKTALHLSEQWSE
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|