Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacT-ataR/DUF1778(antitoxin) |
Location | 1028235..1028989 | Replicon | chromosome |
Accession | NZ_CP117820 | ||
Organism | Xylella fastidiosa strain ICMP 8740 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | PT012_RS04685 | Protein ID | WP_021358673.1 |
Coordinates | 1028235..1028714 (-) | Length | 160 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | - |
Locus tag | PT012_RS04690 | Protein ID | WP_004085396.1 |
Coordinates | 1028717..1028989 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT012_RS04660 (PT012_04660) | 1023492..1024928 | + | 1437 | WP_027700685.1 | exodeoxyribonuclease I | - |
PT012_RS04665 (PT012_04665) | 1024925..1025611 | + | 687 | WP_012337799.1 | TIGR02453 family protein | - |
PT012_RS04670 (PT012_04670) | 1025742..1026740 | + | 999 | WP_004085391.1 | MBL fold metallo-hydrolase | - |
PT012_RS04675 (PT012_04675) | 1026715..1026789 | + | 75 | Protein_899 | hypothetical protein | - |
PT012_RS04680 (PT012_04680) | 1026835..1027899 | + | 1065 | WP_080654483.1 | toprim domain-containing protein | - |
PT012_RS04685 (PT012_04685) | 1028235..1028714 | - | 480 | WP_021358673.1 | GNAT family N-acetyltransferase | Toxin |
PT012_RS04690 (PT012_04690) | 1028717..1028989 | - | 273 | WP_004085396.1 | DUF1778 domain-containing protein | Antitoxin |
PT012_RS04695 (PT012_04695) | 1029341..1030246 | - | 906 | WP_004085395.1 | AEC family transporter | - |
PT012_RS04700 (PT012_04700) | 1030362..1030980 | + | 619 | Protein_904 | IS607 family transposase | - |
PT012_RS04705 (PT012_04705) | 1031208..1033241 | + | 2034 | WP_234545896.1 | glycoside hydrolase family 3 protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 160 a.a. Molecular weight: 17645.42 Da Isoelectric Point: 9.9283
>T272296 WP_021358673.1 NZ_CP117820:c1028714-1028235 [Xylella fastidiosa]
MQISTPHSLTAAHRLDEFNCGEPSLDDWLKRRALTNHLNGASRTFVVIDANQYVLGYYALAAGAVAHQEATRAIRRNMPD
PVPVMVLGRLAVDTRAQGIKLGAALLKDTVTRVQSIAENAGVRALVVHALNERAKQFYEYYGFRASPMHLMTLMLPIKF
MQISTPHSLTAAHRLDEFNCGEPSLDDWLKRRALTNHLNGASRTFVVIDANQYVLGYYALAAGAVAHQEATRAIRRNMPD
PVPVMVLGRLAVDTRAQGIKLGAALLKDTVTRVQSIAENAGVRALVVHALNERAKQFYEYYGFRASPMHLMTLMLPIKF
Download Length: 480 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|