Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK-MazE |
| Location | 889108..889649 | Replicon | chromosome |
| Accession | NZ_CP117820 | ||
| Organism | Xylella fastidiosa strain ICMP 8740 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | PT012_RS04090 | Protein ID | WP_027700637.1 |
| Coordinates | 889108..889431 (-) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | PT012_RS04095 | Protein ID | WP_027700636.1 |
| Coordinates | 889428..889649 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PT012_RS04055 (PT012_04055) | 884254..884460 | + | 207 | WP_071870022.1 | hypothetical protein | - |
| PT012_RS04060 (PT012_04060) | 884469..884693 | + | 225 | WP_038284180.1 | major capsid protein | - |
| PT012_RS04065 (PT012_04065) | 884772..886220 | + | 1449 | WP_155238085.1 | virulence factor TspB C-terminal domain-related protein | - |
| PT012_RS04070 (PT012_04070) | 886224..886565 | + | 342 | WP_027700640.1 | DUF2523 family protein | - |
| PT012_RS04075 (PT012_04075) | 886565..887698 | + | 1134 | WP_080654478.1 | zonular occludens toxin domain-containing protein | - |
| PT012_RS04080 (PT012_04080) | 887713..887982 | - | 270 | WP_027700639.1 | septation ring formation regulator EzrA | - |
| PT012_RS04085 (PT012_04085) | 888244..889074 | + | 831 | WP_027700638.1 | site-specific integrase | - |
| PT012_RS04090 (PT012_04090) | 889108..889431 | - | 324 | WP_027700637.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PT012_RS04095 (PT012_04095) | 889428..889649 | - | 222 | WP_027700636.1 | antitoxin MazE family protein | Antitoxin |
| PT012_RS04100 (PT012_04100) | 889825..890085 | - | 261 | WP_247644640.1 | DUF3693 domain-containing protein | - |
| PT012_RS04105 (PT012_04105) | 890383..891027 | - | 645 | WP_004085407.1 | histidine phosphatase family protein | - |
| PT012_RS04110 (PT012_04110) | 891114..893189 | - | 2076 | WP_027700727.1 | S46 family peptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11799.86 Da Isoelectric Point: 7.9848
>T272295 WP_027700637.1 NZ_CP117820:c889431-889108 [Xylella fastidiosa]
MIQRGDLVTVSLQGDYGKPRPALIVQSDLLTELDSVVLCPVTSDLRNAIFRVTVEPTAANGLRTLSQVMVDKISTLPRNK
ISEPFGRLNDERMKAIERALLLIIGII
MIQRGDLVTVSLQGDYGKPRPALIVQSDLLTELDSVVLCPVTSDLRNAIFRVTVEPTAANGLRTLSQVMVDKISTLPRNK
ISEPFGRLNDERMKAIERALLLIIGII
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|